From 117e3715b4ba7e229f89a7e0a0b521b8474bf68e Mon Sep 17 00:00:00 2001 From: Faerbit Date: Mon, 1 Dec 2014 12:53:19 +0100 Subject: [PATCH] Updating glfw to version 3.0.4. --- extern/glfw/.gitignore | 2 +- extern/glfw/CMakeLists.txt | 76 +- extern/glfw/README.md | 277 ++---- extern/glfw/deps/GL/glext.h | 877 +++++++++--------- extern/glfw/deps/GL/glxext.h | 4 +- extern/glfw/deps/GL/wglext.h | 12 +- extern/glfw/docs/CMakeLists.txt | 10 +- extern/glfw/docs/Doxyfile.in | 7 +- extern/glfw/docs/build.dox | 22 +- extern/glfw/docs/compat.dox | 16 +- extern/glfw/docs/compile.dox | 261 ++++++ extern/glfw/docs/context.dox | 9 + extern/glfw/docs/extra.css | 312 +++++++ extern/glfw/docs/footer.html | 7 + extern/glfw/docs/header.html | 34 + extern/glfw/docs/internal.dox | 4 +- extern/glfw/docs/main.dox | 4 +- extern/glfw/docs/moving.dox | 21 +- extern/glfw/docs/news.dox | 4 +- extern/glfw/docs/quick.dox | 3 + extern/glfw/docs/window.dox | 20 +- extern/glfw/examples/CMakeLists.txt | 60 ++ extern/glfw/examples/boing.c | 628 +++++++++++++ extern/glfw/examples/gears.c | 372 ++++++++ extern/glfw/examples/heightmap.c | 678 ++++++++++++++ extern/glfw/examples/simple.c | 101 ++ extern/glfw/examples/splitview.c | 511 ++++++++++ extern/glfw/examples/wave.c | 457 +++++++++ extern/glfw/include/GLFW/glfw3.h | 152 +-- extern/glfw/src/CMakeLists.txt | 7 +- extern/glfw/src/cocoa_init.m | 2 +- extern/glfw/src/cocoa_joystick.m | 32 +- extern/glfw/src/cocoa_monitor.m | 40 +- extern/glfw/src/cocoa_platform.h | 2 - extern/glfw/src/cocoa_window.m | 148 +-- extern/glfw/src/context.c | 45 +- extern/glfw/src/glfw3.pc.in | 2 +- .../src/{config.h.in => glfw_config.h.in} | 17 +- extern/glfw/src/glx_context.c | 12 +- extern/glfw/src/glx_platform.h | 2 + extern/glfw/src/input.c | 13 +- extern/glfw/src/internal.h | 21 +- extern/glfw/src/nsgl_context.m | 21 +- extern/glfw/src/wgl_context.c | 18 +- extern/glfw/src/win32_init.c | 4 +- extern/glfw/src/win32_joystick.c | 4 +- extern/glfw/src/win32_platform.h | 14 +- extern/glfw/src/win32_time.c | 52 +- extern/glfw/src/win32_window.c | 64 +- extern/glfw/src/window.c | 10 +- extern/glfw/src/x11_init.c | 4 +- extern/glfw/src/x11_joystick.c | 9 - extern/glfw/src/x11_monitor.c | 3 + extern/glfw/src/x11_platform.h | 1 + extern/glfw/src/x11_window.c | 106 ++- extern/glfw/tests/CMakeLists.txt | 71 ++ extern/glfw/tests/accuracy.c | 129 +++ extern/glfw/tests/clipboard.c | 149 +++ extern/glfw/tests/defaults.c | 131 +++ extern/glfw/tests/events.c | 480 ++++++++++ extern/glfw/tests/fsaa.c | 158 ++++ extern/glfw/tests/gamma.c | 175 ++++ extern/glfw/tests/glfwinfo.c | 396 ++++++++ extern/glfw/tests/iconify.c | 176 ++++ extern/glfw/tests/joysticks.c | 234 +++++ extern/glfw/tests/modes.c | 239 +++++ extern/glfw/tests/peter.c | 156 ++++ extern/glfw/tests/reopen.c | 177 ++++ extern/glfw/tests/sharing.c | 185 ++++ extern/glfw/tests/tearing.c | 130 +++ extern/glfw/tests/threads.c | 132 +++ extern/glfw/tests/title.c | 76 ++ extern/glfw/tests/windows.c | 98 ++ 73 files changed, 7871 insertions(+), 1015 deletions(-) create mode 100644 extern/glfw/docs/compile.dox create mode 100644 extern/glfw/docs/extra.css create mode 100644 extern/glfw/docs/footer.html create mode 100644 extern/glfw/docs/header.html create mode 100644 extern/glfw/examples/CMakeLists.txt create mode 100644 extern/glfw/examples/boing.c create mode 100644 extern/glfw/examples/gears.c create mode 100644 extern/glfw/examples/heightmap.c create mode 100644 extern/glfw/examples/simple.c create mode 100644 extern/glfw/examples/splitview.c create mode 100644 extern/glfw/examples/wave.c rename extern/glfw/src/{config.h.in => glfw_config.h.in} (85%) create mode 100644 extern/glfw/tests/CMakeLists.txt create mode 100644 extern/glfw/tests/accuracy.c create mode 100644 extern/glfw/tests/clipboard.c create mode 100644 extern/glfw/tests/defaults.c create mode 100644 extern/glfw/tests/events.c create mode 100644 extern/glfw/tests/fsaa.c create mode 100644 extern/glfw/tests/gamma.c create mode 100644 extern/glfw/tests/glfwinfo.c create mode 100644 extern/glfw/tests/iconify.c create mode 100644 extern/glfw/tests/joysticks.c create mode 100644 extern/glfw/tests/modes.c create mode 100644 extern/glfw/tests/peter.c create mode 100644 extern/glfw/tests/reopen.c create mode 100644 extern/glfw/tests/sharing.c create mode 100644 extern/glfw/tests/tearing.c create mode 100644 extern/glfw/tests/threads.c create mode 100644 extern/glfw/tests/title.c create mode 100644 extern/glfw/tests/windows.c diff --git a/extern/glfw/.gitignore b/extern/glfw/.gitignore index 3ba142e..4ec9d0b 100644 --- a/extern/glfw/.gitignore +++ b/extern/glfw/.gitignore @@ -21,7 +21,7 @@ cmake_uninstall.cmake docs/Doxyfile docs/html docs/warnings.txt -src/config.h +src/glfw_config.h src/glfw3.pc src/glfwConfig.cmake src/glfwConfigVersion.cmake diff --git a/extern/glfw/CMakeLists.txt b/extern/glfw/CMakeLists.txt index 49c119f..0a80900 100644 --- a/extern/glfw/CMakeLists.txt +++ b/extern/glfw/CMakeLists.txt @@ -4,15 +4,16 @@ cmake_minimum_required(VERSION 2.8) set(GLFW_VERSION_MAJOR "3") set(GLFW_VERSION_MINOR "0") -set(GLFW_VERSION_PATCH "2") +set(GLFW_VERSION_PATCH "4") set(GLFW_VERSION_EXTRA "") set(GLFW_VERSION "${GLFW_VERSION_MAJOR}.${GLFW_VERSION_MINOR}") set(GLFW_VERSION_FULL "${GLFW_VERSION}.${GLFW_VERSION_PATCH}${GLFW_VERSION_EXTRA}") set(LIB_SUFFIX "" CACHE STRING "Takes an empty string or 64. Directory where lib will be installed: lib or lib64") option(BUILD_SHARED_LIBS "Build shared libraries" OFF) -option(GLFW_BUILD_EXAMPLES "Build the GLFW example programs" OFF) -option(GLFW_BUILD_TESTS "Build the GLFW test programs" OFF) +option(GLFW_BUILD_EXAMPLES "Build the GLFW example programs" ON) +option(GLFW_BUILD_TESTS "Build the GLFW test programs" ON) +option(GLFW_BUILD_DOCS "Build the GLFW documentation" ON) option(GLFW_INSTALL "Generate installation target" ON) option(GLFW_DOCUMENT_INTERNALS "Include internals in documentation" OFF) @@ -73,11 +74,13 @@ endif() find_package(Threads REQUIRED) -set(DOXYGEN_SKIP_DOT TRUE) -find_package(Doxygen) +if (GLFW_BUILD_DOCS) + set(DOXYGEN_SKIP_DOT TRUE) + find_package(Doxygen) -if (GLFW_DOCUMENT_INTERNALS) - set(GLFW_INTERNAL_DOCS "${GLFW_SOURCE_DIR}/src/internal.h ${GLFW_SOURCE_DIR}/docs/internal.dox") + if (GLFW_DOCUMENT_INTERNALS) + set(GLFW_INTERNAL_DOCS "${GLFW_SOURCE_DIR}/src/internal.h ${GLFW_SOURCE_DIR}/docs/internal.dox") + endif() endif() #-------------------------------------------------------------------- @@ -163,6 +166,13 @@ if (_GLFW_WIN32) if (GLFW_USE_OPTIMUS_HPG) set(_GLFW_USE_OPTIMUS_HPG 1) endif() + + # HACK: When building on MinGW, WINVER and UNICODE need to be defined before + # the inclusion of stddef.h (by glfw3.h), which is itself included before + # win32_platform.h. We define them here until a saner solution can be found + # NOTE: MinGW-w64 and Visual C++ do /not/ need this hack. + add_definitions(-DUNICODE) + add_definitions(-DWINVER=0x0501) endif() #-------------------------------------------------------------------- @@ -204,7 +214,13 @@ if (_GLFW_X11) endif() list(APPEND glfw_INCLUDE_DIRS ${X11_Xinput_INCLUDE_PATH}) - list(APPEND glfw_LIBRARIES ${X11_Xinput_LIB}) + + if (X11_Xinput_LIB) + list(APPEND glfw_LIBRARIES ${X11_Xinput_LIB}) + else() + # Backwards compatibility (bug in CMake 2.8.7) + list(APPEND glfw_LIBRARIES Xi) + endif() set(GLFW_PKG_DEPS "${GLFW_PKG_DEPS} xi") # Check for Xf86VidMode (fallback gamma control) @@ -269,23 +285,15 @@ if (_GLFW_GLX) # Check for dlopen support as a fallback - find_library(DL_LIBRARY dl) - mark_as_advanced(DL_LIBRARY) - if (DL_LIBRARY) - set(CMAKE_REQUIRED_LIBRARIES ${DL_LIBRARY}) - else() - set(CMAKE_REQUIRED_LIBRARIES "") - endif() - + set(CMAKE_REQUIRED_LIBRARIES ${CMAKE_DL_LIBS}) check_function_exists(dlopen _GLFW_HAS_DLOPEN) - if (NOT _GLFW_HAS_DLOPEN) message(FATAL_ERROR "No entry point retrieval mechanism found") endif() - if (DL_LIBRARY) - list(APPEND glfw_LIBRARIES ${DL_LIBRARY}) - set(GLFW_PKG_LIBS "${GLFW_PKG_LIBS} -ldl") + if (CMAKE_DL_LIBS) + list(APPEND glfw_LIBRARIES ${CMAKE_DL_LIBS}) + set(GLFW_PKG_LIBS "${GLFW_PKG_LIBS} -l${CMAKE_DL_LIBS}") endif() endif() @@ -343,13 +351,15 @@ if (_GLFW_COCOA AND _GLFW_NSGL) find_library(COCOA_FRAMEWORK Cocoa) find_library(IOKIT_FRAMEWORK IOKit) find_library(CORE_FOUNDATION_FRAMEWORK CoreFoundation) + find_library(CORE_VIDEO_FRAMEWORK CoreVideo) list(APPEND glfw_LIBRARIES ${COCOA_FRAMEWORK} ${OPENGL_gl_LIBRARY} ${IOKIT_FRAMEWORK} - ${CORE_FOUNDATION_FRAMEWORK}) + ${CORE_FOUNDATION_FRAMEWORK} + ${CORE_VIDEO_FRAMEWORK}) set(GLFW_PKG_DEPS "") - set(GLFW_PKG_LIBS "-framework Cocoa -framework OpenGL -framework IOKit -framework CoreFoundation") + set(GLFW_PKG_LIBS "-framework Cocoa -framework OpenGL -framework IOKit -framework CoreFoundation -framework CoreVideo") endif() #-------------------------------------------------------------------- @@ -373,8 +383,8 @@ endif() configure_file(${GLFW_SOURCE_DIR}/docs/Doxyfile.in ${GLFW_BINARY_DIR}/docs/Doxyfile @ONLY) -configure_file(${GLFW_SOURCE_DIR}/src/config.h.in - ${GLFW_BINARY_DIR}/src/config.h @ONLY) +configure_file(${GLFW_SOURCE_DIR}/src/glfw_config.h.in + ${GLFW_BINARY_DIR}/src/glfw_config.h @ONLY) configure_file(${GLFW_SOURCE_DIR}/src/glfwConfig.cmake.in ${GLFW_BINARY_DIR}/src/glfwConfig.cmake @ONLY) @@ -392,17 +402,17 @@ endif() #-------------------------------------------------------------------- add_subdirectory(src) -#if (GLFW_BUILD_EXAMPLES) -# add_subdirectory(examples) -#endif() +if (GLFW_BUILD_EXAMPLES) + add_subdirectory(examples) +endif() -#if (GLFW_BUILD_TESTS) -# add_subdirectory(tests) -#endif() +if (GLFW_BUILD_TESTS) + add_subdirectory(tests) +endif() -#if (DOXYGEN_FOUND) -# add_subdirectory(docs) -#endif() +if (DOXYGEN_FOUND AND GLFW_BUILD_DOCS) + add_subdirectory(docs) +endif() #-------------------------------------------------------------------- # Install files other than the library diff --git a/extern/glfw/README.md b/extern/glfw/README.md index a120479..830d494 100644 --- a/extern/glfw/README.md +++ b/extern/glfw/README.md @@ -6,9 +6,9 @@ GLFW is a free, Open Source, portable library for OpenGL and OpenGL ES application development. It provides a simple, platform-independent API for creating windows and contexts, reading input, handling events, etc. -Version 3.0.2 adds support for OpenGL 4 on and precise scrolling deltas on OS -X and fixes for a number of bugs that together affect all supported platforms. -As this is a patch release, there are no API changes. +Version 3.0.4 adds better support for custom build environments and fixes for +a large number of bugs that together affect all supported platforms. As this is +a patch release, there are no API changes. If you are new to GLFW, you may find the [introductory tutorial](http://www.glfw.org/docs/latest/quick.html) for GLFW @@ -19,221 +19,69 @@ the GLFW 3 API. ## Compiling GLFW -### Dependencies - -To compile GLFW and the accompanying example programs, you will need **CMake**, -which will generate the project files or makefiles for your particular -development environment. If you are on a Unix-like system such as Linux or -FreeBSD or have a package system like Fink, MacPorts, Cygwin or Homebrew, you -can simply install its CMake package. If not, you can get installers for -Windows and OS X from the [CMake website](http://www.cmake.org/). - -Additional dependencies are listed below. - - -#### Visual C++ on Windows - -The Microsoft Platform SDK that is installed along with Visual C++ contains all -the necessary headers, link libraries and tools except for CMake. - - -#### MinGW or MinGW-w64 on Windows - -These packages contain all the necessary headers, link libraries and tools -except for CMake. - - -#### MinGW or MinGW-w64 cross-compilation - -Both Cygwin and many Linux distributions have MinGW or MinGW-w64 packages. For -example, Cygwin has the `mingw64-i686-gcc` and `mingw64-x86_64-gcc` packages -for 32- and 64-bit version of MinGW-w64, while Debian GNU/Linux and derivatives -like Ubuntu have the `mingw-w64` package for both. - -GLFW has CMake toolchain files in the `CMake/` directory that allow for easy -cross-compilation of Windows binaries. To use these files you need to add a -special parameter when generating the project files or makefiles: - - cmake -DCMAKE_TOOLCHAIN_FILE= . - -The exact toolchain file to use depends on the prefix used by the MinGW or -MinGW-w64 binaries on your system. You can usually see this in the /usr -directory. For example, both the Debian/Ubuntu and Cygwin MinGW-w64 packages -have `/usr/x86_64-w64-mingw32` for the 64-bit compilers, so the correct -invocation would be: - - cmake -DCMAKE_TOOLCHAIN_FILE=CMake/x86_64-w64-mingw32.cmake . - -For more details see the article -[CMake Cross Compiling](http://www.paraview.org/Wiki/CMake_Cross_Compiling) on -the CMake wiki. - - -#### Xcode on OS X - -Xcode contains all necessary tools except for CMake. The necessary headers and -libraries are included in the core OS frameworks. Xcode can be downloaded from -the Mac App Store. - - -#### Unix-like systems with X11 - -To compile GLFW for X11, you need to have the X11 and OpenGL header packages -installed, as well as the basic development tools like GCC and make. For -example, on Ubuntu and other distributions based on Debian GNU/Linux, you need -to install the `xorg-dev` and `libglu1-mesa-dev` packages. The former pulls in -all X.org header packages and the latter pulls in the Mesa OpenGL and GLU -packages. Note that using header files and libraries from Mesa during -compilation *will not* tie your binaries to the Mesa implementation of OpenGL. - - -### Generating with CMake - -Once you have all necessary dependencies, it is time to generate the project -files or makefiles for your development environment. CMake needs to know two -paths for this: the path to the source directory and the target path for the -generated files and compiled binaries. If these are the same, it is called an -in-tree build, otherwise it is called an out-of-tree build. - -One of several advantages of out-of-tree builds is that you can generate files -and compile for different development environments using a single source tree. - - -#### Using CMake from the command-line - -To make an in-tree build, enter the root directory of the GLFW source tree and -run CMake. The current directory is used as target path, while the path -provided as an argument is used to find the source tree. - - cd - cmake . - -To make an out-of-tree build, make another directory, enter it and run CMake -with the (relative or absolute) path to the root of the source tree as an -argument. - - cd - mkdir build - cd build - cmake .. - - -#### Using the CMake GUI - -If you are using the GUI version, choose the root of the GLFW source tree as -source location and the same directory or another, empty directory as the -destination for binaries. Choose *Configure*, change any options you wish to, -*Configure* again to let the changes take effect and then *Generate*. - - -### CMake options - -The CMake files for GLFW provide a number of options, although not all are -available on all supported platforms. Some of these are de facto standards -among CMake users and so have no `GLFW_` prefix. - -If you are using the GUI version of CMake, these are listed and can be changed -from there. If you are using the command-line version, use the `ccmake` tool. -Some package systems like Ubuntu and other distributions based on Debian -GNU/Linux have this tool in a separate `cmake-curses-gui` package. - - -#### Shared options - -`BUILD_SHARED_LIBS` determines whether GLFW is built as a static -library or as a DLL / shared library / dynamic library. - -`LIB_SUFFIX` affects where the GLFW shared /dynamic library is -installed. If it is empty, it is installed to `$PREFIX/lib`. If it is set to -`64`, it is installed to `$PREFIX/lib64`. - -`GLFW_BUILD_EXAMPLES` determines whether the GLFW examples are built -along with the library. - -`GLFW_BUILD_TESTS` determines whether the GLFW test programs are -built along with the library. - - -#### OS X specific options - -`GLFW_USE_CHDIR` determines whether `glfwInit` changes the current -directory of bundled applications to the `Contents/Resources` directory. - -`GLFW_USE_MENUBAR` determines whether the first call to -`glfwCreateWindow` sets up a minimal menu bar. - -`GLFW_BUILD_UNIVERSAL` determines whether to build Universal Binaries. - - -#### Windows specific options - -`USE_MSVC_RUNTIME_LIBRARY_DLL` determines whether to use the DLL version or the -static library version of the Visual C++ runtime library. - -`GLFW_USE_DWM_SWAP_INTERVAL` determines whether the swap interval is set even -when DWM compositing is enabled. This can lead to severe jitter and is not -usually recommended. - -`GLFW_USE_OPTIMUS_HPG` determines whether to export the `NvOptimusEnablement` -symbol, which forces the use of the high-performance GPU on nVidia Optimus -systems. - - -#### EGL specific options - -`GLFW_USE_EGL` determines whether to use EGL instead of the platform-specific -context creation API. Note that EGL is not yet provided on all supported -platforms. - -`GLFW_CLIENT_LIBRARY` determines which client API library to use. If set to -`opengl` the OpenGL library is used, if set to `glesv1` for the OpenGL ES 1.x -library is used, or if set to `glesv2` the OpenGL ES 2.0 library is used. The -selected library and its header files must be present on the system for this to -work. - - -## Installing GLFW - -A rudimentary installation target is provided for all supported platforms via -CMake. +See the [Compiling GLFW](http://www.glfw.org/docs/latest/compile.html) guide in +the GLFW documentation. ## Using GLFW -See the [GLFW documentation](http://www.glfw.org/docs/latest/). +See the +[Building programs that use GLFW](http://www.glfw.org/docs/latest/build.html) +guide in the GLFW documentation. ## Changelog - - Allowed character callback to be triggered regardless of modifier keys - - Bugfix: The `-Wall` flag was not used with Clang and other GCC compatibles - - Bugfix: The default for `GLFW_ALPHA_BITS` was set to zero - - Bugfix: `glfwInit` would segfault if monitor enumeration failed and no error - callback was set - - [Win32] Added `_GLFW_USE_DWM_SWAP_INTERVAL` for forcing the swap interval - to be set even when DWM compositing is enabled - - [Win32] Added support for forcing the use of the high-performance GPU - on nVidia Optimus systems - - [Win32] Bugfix: The clipboard string was not freed on terminate - - [Win32] Bugfix: Entry points for OpenGL 1.0 and 1.1 functions were not - returned by `glfwGetProcAddress` - - [Win32] Bugfix: The `user32` and `dwmapi` module handles were not freed on - library termination - - [Cocoa] Added support for precise scrolling deltas on OS X 10.7 and later - - [Cocoa] Enabled explicit creation of OpenGL 3.x and 4.x contexts as supported - by OS X 10.9 - - [Cocoa] Bugfix: The clipboard string was not freed on terminate - - [Cocoa] Bugfix: Selectors were used that are not declared by the 10.6 SDK - - [Cocoa] Bugfix: The position set by `glfwSetWindowPos` was incorrect - - [X11] Bugfix: Override-redirect windows were resized to the desired instead - of the actual resolution of the selected video mode - - [X11] Bugfix: Screensaver override for full screen windows had a possible - race condition - - [X11] Bugfix: The reported window position did not account for the size of - the window frame on some WMs - - [X11] Bugfix: The original video mode of a monitor was overwritten by calls - to `glfwSetWindowSize` - - [X11] Bugfix: Key release events for `GLFW_KEY_KP_5` were discarded. + - Added the `GLFW_BUILD_DOCS` CMake option for controlling whether the + documentation is built + - Added the `_GLFW_USE_CONFIG_H` configuration macro for controlling whether to + include the configuration header + - Moved version number macro to `internal.h` for easier manual compilation + - Renamed configuration header to `glfw_config.h` to avoid conflicts + - Bugfix: The `glfw3.pc` file did not respect the `LIB_SUFFIX` CMake option + - Bugfix: The `joysticks` test would segfault if a controller had no axes + - [Win32] Allowed swap interval to be explicitly set to zero on DWM systems + - [Win32] Bugfix: Removed joystick axis value negation left over from GLFW 2 + - [Win32] Bugfix: Restoring windows using the Win+D hot key did not trigger the + focus callback + - [Win32] Bugfix: The disabled cursor mode clip rectangle was updated for + unfocused windows + - [Win32] Bugfix: Cursor was not properly re-centered over odd-sized windows + - [Win32] Bugfix: Negative window positions were reported incorrectly + - [Win32] Bugfix: The iconify callback was not triggered when switching away + from a full screen window using Alt+Tab + - [Win32] Bugfix: Resizing a window with `glfwSetWindowSize` gave it focus + - [Cocoa] Added dependency on CoreVideo framework for refresh rate retrieval + - [Cocoa] Enabled Lion full screen for resizable windowed mode windows + - [Cocoa] Moved to Cocoa API for application transformation and activation + - [Cocoa] Bugfix: The `GLFW_KEY_GRAVE_ACCENT` key was reported as + `GLFW_KEY_WORLD_1` and vice versa + - [Cocoa] Bugfix: The `GLFW_KEY_F13` key was reported as + `GLFW_KEY_PRINT_SCREEN` + - [Cocoa] Bugfix: Implicit conversion from `NSUInteger` to int caused warnings + with Xcode 5 + - [Cocoa] Bugfix: Use of undeclared selectors with `@selector` caused warnings + with Xcode 5 + - [Cocoa] Bugfix: The cursor remained visible if moved onto client area after + having been set to hidden outside it + - [Cocoa] Bugfix: The refresh rate was zero for all modes of certain monitors + - [Cocoa] Bugfix: The `install_name` field of the dynamic library was not set + - [Cocoa] Bugfix: Full screen windows were never reported as having focus + - [Cocoa] Bugfix: A superfluous I/O flag test prevented video modes from being + listed for Thunderbolt monitor + - [Cocoa] Bugfix: Retrieving the name of some external displays caused segfault + - [Cocoa] Bugfix: The 10.9 SDK defines `GLintptrARB` and `GLsizeiptrARB` + differently from the Khronos `glext.h` + - [Cocoa] Bugfix: Creating hidden windows would steal application focus + - [Cocoa] Bugfix: Controllers were reported as having zero buttons and axes + - [Cocoa] Bugfix: Removed joystick axis value negation left over from GLFW 2 + - [X11] Added setting of the `WM_CLASS` property to the initial window title + - [X11] Added support for `_NET_WM_BYPASS_COMPOSITOR` + - [X11] Bugfix: Removed joystick axis value negation left over from GLFW 2 + - [X11] Bugfix: The position of hidden windows was ignored by Metacity + and Compiz + - [X11] Bugfix: The `pthread.h` header was not included by the GLX platform + header. ## Contact @@ -272,12 +120,14 @@ skills. - Doug Binks - blanco - Lambert Clara + - Andrew Corrigan - Noel Cower - Jarrod Davis - Olivier Delannoy - Paul R. Deppe - Jonathan Dummer - Ralph Eastwood + - Michael Fogleman - Gerald Franz - GeO4d - Marcus Geelnard @@ -302,13 +152,18 @@ skills. - Marcel Metz - Kenneth Miller - Bruce Mitchener + - Jack Moffitt - Jeff Molofee - Jon Morton + - Pierre Moulon - Julian Møller + - Kamil Nowakowski - Ozzy + - Andri Pálsson - Peoro - Braden Pellett - Arturo J. Pérez + - Pieroman - Jorge Rodriguez - Ed Ropple - Riku Salminen @@ -316,6 +171,7 @@ skills. - Matt Sealey - SephiRok - Steve Sexton + - Systemcluster - Dmitri Shuralyov - Daniel Skorupski - Bradley Smith @@ -326,6 +182,7 @@ skills. - TTK-Bandit - Sergey Tikhomirov - Samuli Tuomola + - urraka - Jari Vetoniemi - Simon Voordouw - Torsten Walluhn diff --git a/extern/glfw/deps/GL/glext.h b/extern/glfw/deps/GL/glext.h index fa506fa..4edeae9 100644 --- a/extern/glfw/deps/GL/glext.h +++ b/extern/glfw/deps/GL/glext.h @@ -33,7 +33,7 @@ extern "C" { ** used to make the header, and the header can be found at ** http://www.opengl.org/registry/ ** -** Khronos $Revision$ on $Date$ +** Khronos $Revision: 23695 $ on $Date: 2013-10-24 12:37:40 -0700 (Thu, 24 Oct 2013) $ */ #if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__) @@ -53,7 +53,7 @@ extern "C" { #define GLAPI extern #endif -#define GL_GLEXT_VERSION 20130721 +#define GL_GLEXT_VERSION 20131024 /* Generated C header for: * API: gl @@ -108,18 +108,14 @@ extern "C" { #define GL_SINGLE_COLOR 0x81F9 #define GL_SEPARATE_SPECULAR_COLOR 0x81FA #define GL_ALIASED_POINT_SIZE_RANGE 0x846D -typedef void (APIENTRYP PFNGLBLENDCOLORPROC) (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); -typedef void (APIENTRYP PFNGLBLENDEQUATIONPROC) (GLenum mode); -typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); -typedef void (APIENTRYP PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices); +typedef void (APIENTRYP PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glBlendColor (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); -GLAPI void APIENTRY glBlendEquation (GLenum mode); -GLAPI void APIENTRY glDrawRangeElements (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); -GLAPI void APIENTRY glTexImage3D (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glDrawRangeElements (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices); +GLAPI void APIENTRY glTexImage3D (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); GLAPI void APIENTRY glCopyTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); #endif #endif /* GL_VERSION_1_2 */ @@ -224,13 +220,13 @@ GLAPI void APIENTRY glCopyTexSubImage3D (GLenum target, GLint level, GLint xoffs #define GL_DOT3_RGBA 0x86AF typedef void (APIENTRYP PFNGLACTIVETEXTUREPROC) (GLenum texture); typedef void (APIENTRYP PFNGLSAMPLECOVERAGEPROC) (GLfloat value, GLboolean invert); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, GLvoid *img); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, void *img); typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREPROC) (GLenum texture); typedef void (APIENTRYP PFNGLMULTITEXCOORD1DPROC) (GLenum target, GLdouble s); typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVPROC) (GLenum target, const GLdouble *v); @@ -271,13 +267,13 @@ typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDPROC) (const GLdouble *m); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glActiveTexture (GLenum texture); GLAPI void APIENTRY glSampleCoverage (GLfloat value, GLboolean invert); -GLAPI void APIENTRY glCompressedTexImage3D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexImage2D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexImage1D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexSubImage1D (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glGetCompressedTexImage (GLenum target, GLint level, GLvoid *img); +GLAPI void APIENTRY glCompressedTexImage3D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexImage2D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexImage1D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage1D (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glGetCompressedTexImage (GLenum target, GLint level, void *img); GLAPI void APIENTRY glClientActiveTexture (GLenum texture); GLAPI void APIENTRY glMultiTexCoord1d (GLenum target, GLdouble s); GLAPI void APIENTRY glMultiTexCoord1dv (GLenum target, const GLdouble *v); @@ -359,9 +355,18 @@ GLAPI void APIENTRY glMultTransposeMatrixd (const GLdouble *m); #define GL_TEXTURE_FILTER_CONTROL 0x8500 #define GL_DEPTH_TEXTURE_MODE 0x884B #define GL_COMPARE_R_TO_TEXTURE 0x884E +#define GL_FUNC_ADD 0x8006 +#define GL_FUNC_SUBTRACT 0x800A +#define GL_FUNC_REVERSE_SUBTRACT 0x800B +#define GL_MIN 0x8007 +#define GL_MAX 0x8008 +#define GL_CONSTANT_COLOR 0x8001 +#define GL_ONE_MINUS_CONSTANT_COLOR 0x8002 +#define GL_CONSTANT_ALPHA 0x8003 +#define GL_ONE_MINUS_CONSTANT_ALPHA 0x8004 typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei drawcount); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid *const*indices, GLsizei drawcount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount); typedef void (APIENTRYP PFNGLPOINTPARAMETERFPROC) (GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLPOINTPARAMETERFVPROC) (GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLPOINTPARAMETERIPROC) (GLenum pname, GLint param); @@ -370,7 +375,7 @@ typedef void (APIENTRYP PFNGLFOGCOORDFPROC) (GLfloat coord); typedef void (APIENTRYP PFNGLFOGCOORDFVPROC) (const GLfloat *coord); typedef void (APIENTRYP PFNGLFOGCOORDDPROC) (GLdouble coord); typedef void (APIENTRYP PFNGLFOGCOORDDVPROC) (const GLdouble *coord); -typedef void (APIENTRYP PFNGLFOGCOORDPOINTERPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLFOGCOORDPOINTERPROC) (GLenum type, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BPROC) (GLbyte red, GLbyte green, GLbyte blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVPROC) (const GLbyte *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DPROC) (GLdouble red, GLdouble green, GLdouble blue); @@ -387,7 +392,7 @@ typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIPROC) (GLuint red, GLuint green, G typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVPROC) (const GLuint *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USPROC) (GLushort red, GLushort green, GLushort blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVPROC) (const GLushort *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERPROC) (GLint size, GLenum type, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLWINDOWPOS2DPROC) (GLdouble x, GLdouble y); typedef void (APIENTRYP PFNGLWINDOWPOS2DVPROC) (const GLdouble *v); typedef void (APIENTRYP PFNGLWINDOWPOS2FPROC) (GLfloat x, GLfloat y); @@ -404,10 +409,12 @@ typedef void (APIENTRYP PFNGLWINDOWPOS3IPROC) (GLint x, GLint y, GLint z); typedef void (APIENTRYP PFNGLWINDOWPOS3IVPROC) (const GLint *v); typedef void (APIENTRYP PFNGLWINDOWPOS3SPROC) (GLshort x, GLshort y, GLshort z); typedef void (APIENTRYP PFNGLWINDOWPOS3SVPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLBLENDCOLORPROC) (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); +typedef void (APIENTRYP PFNGLBLENDEQUATIONPROC) (GLenum mode); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBlendFuncSeparate (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); GLAPI void APIENTRY glMultiDrawArrays (GLenum mode, const GLint *first, const GLsizei *count, GLsizei drawcount); -GLAPI void APIENTRY glMultiDrawElements (GLenum mode, const GLsizei *count, GLenum type, const GLvoid *const*indices, GLsizei drawcount); +GLAPI void APIENTRY glMultiDrawElements (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount); GLAPI void APIENTRY glPointParameterf (GLenum pname, GLfloat param); GLAPI void APIENTRY glPointParameterfv (GLenum pname, const GLfloat *params); GLAPI void APIENTRY glPointParameteri (GLenum pname, GLint param); @@ -416,7 +423,7 @@ GLAPI void APIENTRY glFogCoordf (GLfloat coord); GLAPI void APIENTRY glFogCoordfv (const GLfloat *coord); GLAPI void APIENTRY glFogCoordd (GLdouble coord); GLAPI void APIENTRY glFogCoorddv (const GLdouble *coord); -GLAPI void APIENTRY glFogCoordPointer (GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glFogCoordPointer (GLenum type, GLsizei stride, const void *pointer); GLAPI void APIENTRY glSecondaryColor3b (GLbyte red, GLbyte green, GLbyte blue); GLAPI void APIENTRY glSecondaryColor3bv (const GLbyte *v); GLAPI void APIENTRY glSecondaryColor3d (GLdouble red, GLdouble green, GLdouble blue); @@ -433,7 +440,7 @@ GLAPI void APIENTRY glSecondaryColor3ui (GLuint red, GLuint green, GLuint blue); GLAPI void APIENTRY glSecondaryColor3uiv (const GLuint *v); GLAPI void APIENTRY glSecondaryColor3us (GLushort red, GLushort green, GLushort blue); GLAPI void APIENTRY glSecondaryColor3usv (const GLushort *v); -GLAPI void APIENTRY glSecondaryColorPointer (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glSecondaryColorPointer (GLint size, GLenum type, GLsizei stride, const void *pointer); GLAPI void APIENTRY glWindowPos2d (GLdouble x, GLdouble y); GLAPI void APIENTRY glWindowPos2dv (const GLdouble *v); GLAPI void APIENTRY glWindowPos2f (GLfloat x, GLfloat y); @@ -450,6 +457,8 @@ GLAPI void APIENTRY glWindowPos3i (GLint x, GLint y, GLint z); GLAPI void APIENTRY glWindowPos3iv (const GLint *v); GLAPI void APIENTRY glWindowPos3s (GLshort x, GLshort y, GLshort z); GLAPI void APIENTRY glWindowPos3sv (const GLshort *v); +GLAPI void APIENTRY glBlendColor (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); +GLAPI void APIENTRY glBlendEquation (GLenum mode); #endif #endif /* GL_VERSION_1_4 */ @@ -520,13 +529,13 @@ typedef void (APIENTRYP PFNGLBINDBUFFERPROC) (GLenum target, GLuint buffer); typedef void (APIENTRYP PFNGLDELETEBUFFERSPROC) (GLsizei n, const GLuint *buffers); typedef void (APIENTRYP PFNGLGENBUFFERSPROC) (GLsizei n, GLuint *buffers); typedef GLboolean (APIENTRYP PFNGLISBUFFERPROC) (GLuint buffer); -typedef void (APIENTRYP PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const GLvoid *data, GLenum usage); -typedef void (APIENTRYP PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const GLvoid *data); -typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLvoid *data); +typedef void (APIENTRYP PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const void *data, GLenum usage); +typedef void (APIENTRYP PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const void *data); +typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, void *data); typedef void *(APIENTRYP PFNGLMAPBUFFERPROC) (GLenum target, GLenum access); typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERPROC) (GLenum target); typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, GLvoid **params); +typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, void **params); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glGenQueries (GLsizei n, GLuint *ids); GLAPI void APIENTRY glDeleteQueries (GLsizei n, const GLuint *ids); @@ -540,13 +549,13 @@ GLAPI void APIENTRY glBindBuffer (GLenum target, GLuint buffer); GLAPI void APIENTRY glDeleteBuffers (GLsizei n, const GLuint *buffers); GLAPI void APIENTRY glGenBuffers (GLsizei n, GLuint *buffers); GLAPI GLboolean APIENTRY glIsBuffer (GLuint buffer); -GLAPI void APIENTRY glBufferData (GLenum target, GLsizeiptr size, const GLvoid *data, GLenum usage); -GLAPI void APIENTRY glBufferSubData (GLenum target, GLintptr offset, GLsizeiptr size, const GLvoid *data); -GLAPI void APIENTRY glGetBufferSubData (GLenum target, GLintptr offset, GLsizeiptr size, GLvoid *data); +GLAPI void APIENTRY glBufferData (GLenum target, GLsizeiptr size, const void *data, GLenum usage); +GLAPI void APIENTRY glBufferSubData (GLenum target, GLintptr offset, GLsizeiptr size, const void *data); +GLAPI void APIENTRY glGetBufferSubData (GLenum target, GLintptr offset, GLsizeiptr size, void *data); GLAPI void *APIENTRY glMapBuffer (GLenum target, GLenum access); GLAPI GLboolean APIENTRY glUnmapBuffer (GLenum target); GLAPI void APIENTRY glGetBufferParameteriv (GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetBufferPointerv (GLenum target, GLenum pname, GLvoid **params); +GLAPI void APIENTRY glGetBufferPointerv (GLenum target, GLenum pname, void **params); #endif #endif /* GL_VERSION_1_5 */ @@ -667,7 +676,7 @@ typedef void (APIENTRYP PFNGLGETUNIFORMIVPROC) (GLuint program, GLint location, typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVPROC) (GLuint index, GLenum pname, GLdouble *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVPROC) (GLuint index, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVPROC) (GLuint index, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint index, GLenum pname, GLvoid **pointer); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint index, GLenum pname, void **pointer); typedef GLboolean (APIENTRYP PFNGLISPROGRAMPROC) (GLuint program); typedef GLboolean (APIENTRYP PFNGLISSHADERPROC) (GLuint shader); typedef void (APIENTRYP PFNGLLINKPROGRAMPROC) (GLuint program); @@ -729,7 +738,7 @@ typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVPROC) (GLuint index, const GLshort * typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVPROC) (GLuint index, const GLubyte *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVPROC) (GLuint index, const GLuint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVPROC) (GLuint index, const GLushort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void *pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBlendEquationSeparate (GLenum modeRGB, GLenum modeAlpha); GLAPI void APIENTRY glDrawBuffers (GLsizei n, const GLenum *bufs); @@ -761,7 +770,7 @@ GLAPI void APIENTRY glGetUniformiv (GLuint program, GLint location, GLint *param GLAPI void APIENTRY glGetVertexAttribdv (GLuint index, GLenum pname, GLdouble *params); GLAPI void APIENTRY glGetVertexAttribfv (GLuint index, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetVertexAttribiv (GLuint index, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetVertexAttribPointerv (GLuint index, GLenum pname, GLvoid **pointer); +GLAPI void APIENTRY glGetVertexAttribPointerv (GLuint index, GLenum pname, void **pointer); GLAPI GLboolean APIENTRY glIsProgram (GLuint program); GLAPI GLboolean APIENTRY glIsShader (GLuint shader); GLAPI void APIENTRY glLinkProgram (GLuint program); @@ -823,7 +832,7 @@ GLAPI void APIENTRY glVertexAttrib4sv (GLuint index, const GLshort *v); GLAPI void APIENTRY glVertexAttrib4ubv (GLuint index, const GLubyte *v); GLAPI void APIENTRY glVertexAttrib4uiv (GLuint index, const GLuint *v); GLAPI void APIENTRY glVertexAttrib4usv (GLuint index, const GLushort *v); -GLAPI void APIENTRY glVertexAttribPointer (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glVertexAttribPointer (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void *pointer); #endif #endif /* GL_VERSION_2_0 */ @@ -1107,7 +1116,7 @@ typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKVARYINGPROC) (GLuint program, G typedef void (APIENTRYP PFNGLCLAMPCOLORPROC) (GLenum target, GLenum clamp); typedef void (APIENTRYP PFNGLBEGINCONDITIONALRENDERPROC) (GLuint id, GLenum mode); typedef void (APIENTRYP PFNGLENDCONDITIONALRENDERPROC) (void); -typedef void (APIENTRYP PFNGLVERTEXATTRIBIPOINTERPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXATTRIBIPOINTERPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIIVPROC) (GLuint index, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIUIVPROC) (GLuint index, GLenum pname, GLuint *params); typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IPROC) (GLuint index, GLint x); @@ -1192,7 +1201,7 @@ GLAPI void APIENTRY glGetTransformFeedbackVarying (GLuint program, GLuint index, GLAPI void APIENTRY glClampColor (GLenum target, GLenum clamp); GLAPI void APIENTRY glBeginConditionalRender (GLuint id, GLenum mode); GLAPI void APIENTRY glEndConditionalRender (void); -GLAPI void APIENTRY glVertexAttribIPointer (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glVertexAttribIPointer (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); GLAPI void APIENTRY glGetVertexAttribIiv (GLuint index, GLenum pname, GLint *params); GLAPI void APIENTRY glGetVertexAttribIuiv (GLuint index, GLenum pname, GLuint *params); GLAPI void APIENTRY glVertexAttribI1i (GLuint index, GLint x); @@ -1325,7 +1334,7 @@ GLAPI GLboolean APIENTRY glIsVertexArray (GLuint array); #define GL_UNIFORM_BLOCK_REFERENCED_BY_FRAGMENT_SHADER 0x8A46 #define GL_INVALID_INDEX 0xFFFFFFFFu typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDPROC) (GLenum mode, GLint first, GLsizei count, GLsizei instancecount); -typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDPROC) (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei instancecount); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount); typedef void (APIENTRYP PFNGLTEXBUFFERPROC) (GLenum target, GLenum internalformat, GLuint buffer); typedef void (APIENTRYP PFNGLPRIMITIVERESTARTINDEXPROC) (GLuint index); typedef void (APIENTRYP PFNGLCOPYBUFFERSUBDATAPROC) (GLenum readTarget, GLenum writeTarget, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); @@ -1338,7 +1347,7 @@ typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMBLOCKNAMEPROC) (GLuint program, GLu typedef void (APIENTRYP PFNGLUNIFORMBLOCKBINDINGPROC) (GLuint program, GLuint uniformBlockIndex, GLuint uniformBlockBinding); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDrawArraysInstanced (GLenum mode, GLint first, GLsizei count, GLsizei instancecount); -GLAPI void APIENTRY glDrawElementsInstanced (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei instancecount); +GLAPI void APIENTRY glDrawElementsInstanced (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount); GLAPI void APIENTRY glTexBuffer (GLenum target, GLenum internalformat, GLuint buffer); GLAPI void APIENTRY glPrimitiveRestartIndex (GLuint index); GLAPI void APIENTRY glCopyBufferSubData (GLenum readTarget, GLenum writeTarget, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); @@ -1458,10 +1467,10 @@ typedef int64_t GLint64; #define GL_MAX_COLOR_TEXTURE_SAMPLES 0x910E #define GL_MAX_DEPTH_TEXTURE_SAMPLES 0x910F #define GL_MAX_INTEGER_SAMPLES 0x9110 -typedef void (APIENTRYP PFNGLDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLint basevertex); -typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSBASEVERTEXPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices, GLint basevertex); -typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei instancecount, GLint basevertex); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid *const*indices, GLsizei drawcount, const GLint *basevertex); +typedef void (APIENTRYP PFNGLDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSBASEVERTEXPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount, const GLint *basevertex); typedef void (APIENTRYP PFNGLPROVOKINGVERTEXPROC) (GLenum mode); typedef GLsync (APIENTRYP PFNGLFENCESYNCPROC) (GLenum condition, GLbitfield flags); typedef GLboolean (APIENTRYP PFNGLISSYNCPROC) (GLsync sync); @@ -1473,15 +1482,15 @@ typedef void (APIENTRYP PFNGLGETSYNCIVPROC) (GLsync sync, GLenum pname, GLsizei typedef void (APIENTRYP PFNGLGETINTEGER64I_VPROC) (GLenum target, GLuint index, GLint64 *data); typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERI64VPROC) (GLenum target, GLenum pname, GLint64 *params); typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level); -typedef void (APIENTRYP PFNGLTEXIMAGE2DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLint internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); -typedef void (APIENTRYP PFNGLTEXIMAGE3DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXIMAGE2DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXIMAGE3DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); typedef void (APIENTRYP PFNGLGETMULTISAMPLEFVPROC) (GLenum pname, GLuint index, GLfloat *val); typedef void (APIENTRYP PFNGLSAMPLEMASKIPROC) (GLuint index, GLbitfield mask); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDrawElementsBaseVertex (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLint basevertex); -GLAPI void APIENTRY glDrawRangeElementsBaseVertex (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices, GLint basevertex); -GLAPI void APIENTRY glDrawElementsInstancedBaseVertex (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei instancecount, GLint basevertex); -GLAPI void APIENTRY glMultiDrawElementsBaseVertex (GLenum mode, const GLsizei *count, GLenum type, const GLvoid *const*indices, GLsizei drawcount, const GLint *basevertex); +GLAPI void APIENTRY glDrawElementsBaseVertex (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); +GLAPI void APIENTRY glDrawRangeElementsBaseVertex (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); +GLAPI void APIENTRY glDrawElementsInstancedBaseVertex (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); +GLAPI void APIENTRY glMultiDrawElementsBaseVertex (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount, const GLint *basevertex); GLAPI void APIENTRY glProvokingVertex (GLenum mode); GLAPI GLsync APIENTRY glFenceSync (GLenum condition, GLbitfield flags); GLAPI GLboolean APIENTRY glIsSync (GLsync sync); @@ -1493,8 +1502,8 @@ GLAPI void APIENTRY glGetSynciv (GLsync sync, GLenum pname, GLsizei bufSize, GLs GLAPI void APIENTRY glGetInteger64i_v (GLenum target, GLuint index, GLint64 *data); GLAPI void APIENTRY glGetBufferParameteri64v (GLenum target, GLenum pname, GLint64 *params); GLAPI void APIENTRY glFramebufferTexture (GLenum target, GLenum attachment, GLuint texture, GLint level); -GLAPI void APIENTRY glTexImage2DMultisample (GLenum target, GLsizei samples, GLint internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); -GLAPI void APIENTRY glTexImage3DMultisample (GLenum target, GLsizei samples, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTexImage2DMultisample (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTexImage3DMultisample (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); GLAPI void APIENTRY glGetMultisamplefv (GLenum pname, GLuint index, GLfloat *val); GLAPI void APIENTRY glSampleMaski (GLuint index, GLbitfield mask); #endif @@ -1722,8 +1731,8 @@ typedef void (APIENTRYP PFNGLBLENDEQUATIONIPROC) (GLuint buf, GLenum mode); typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEIPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha); typedef void (APIENTRYP PFNGLBLENDFUNCIPROC) (GLuint buf, GLenum src, GLenum dst); typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEIPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); -typedef void (APIENTRYP PFNGLDRAWARRAYSINDIRECTPROC) (GLenum mode, const GLvoid *indirect); -typedef void (APIENTRYP PFNGLDRAWELEMENTSINDIRECTPROC) (GLenum mode, GLenum type, const GLvoid *indirect); +typedef void (APIENTRYP PFNGLDRAWARRAYSINDIRECTPROC) (GLenum mode, const void *indirect); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINDIRECTPROC) (GLenum mode, GLenum type, const void *indirect); typedef void (APIENTRYP PFNGLUNIFORM1DPROC) (GLint location, GLdouble x); typedef void (APIENTRYP PFNGLUNIFORM2DPROC) (GLint location, GLdouble x, GLdouble y); typedef void (APIENTRYP PFNGLUNIFORM3DPROC) (GLint location, GLdouble x, GLdouble y, GLdouble z); @@ -1769,8 +1778,8 @@ GLAPI void APIENTRY glBlendEquationi (GLuint buf, GLenum mode); GLAPI void APIENTRY glBlendEquationSeparatei (GLuint buf, GLenum modeRGB, GLenum modeAlpha); GLAPI void APIENTRY glBlendFunci (GLuint buf, GLenum src, GLenum dst); GLAPI void APIENTRY glBlendFuncSeparatei (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); -GLAPI void APIENTRY glDrawArraysIndirect (GLenum mode, const GLvoid *indirect); -GLAPI void APIENTRY glDrawElementsIndirect (GLenum mode, GLenum type, const GLvoid *indirect); +GLAPI void APIENTRY glDrawArraysIndirect (GLenum mode, const void *indirect); +GLAPI void APIENTRY glDrawElementsIndirect (GLenum mode, GLenum type, const void *indirect); GLAPI void APIENTRY glUniform1d (GLint location, GLdouble x); GLAPI void APIENTRY glUniform2d (GLint location, GLdouble x, GLdouble y); GLAPI void APIENTRY glUniform3d (GLint location, GLdouble x, GLdouble y, GLdouble z); @@ -1851,12 +1860,12 @@ GLAPI void APIENTRY glGetQueryIndexediv (GLenum target, GLuint index, GLenum pna #define GL_VIEWPORT_INDEX_PROVOKING_VERTEX 0x825F #define GL_UNDEFINED_VERTEX 0x8260 typedef void (APIENTRYP PFNGLRELEASESHADERCOMPILERPROC) (void); -typedef void (APIENTRYP PFNGLSHADERBINARYPROC) (GLsizei count, const GLuint *shaders, GLenum binaryformat, const GLvoid *binary, GLsizei length); +typedef void (APIENTRYP PFNGLSHADERBINARYPROC) (GLsizei count, const GLuint *shaders, GLenum binaryformat, const void *binary, GLsizei length); typedef void (APIENTRYP PFNGLGETSHADERPRECISIONFORMATPROC) (GLenum shadertype, GLenum precisiontype, GLint *range, GLint *precision); typedef void (APIENTRYP PFNGLDEPTHRANGEFPROC) (GLfloat n, GLfloat f); typedef void (APIENTRYP PFNGLCLEARDEPTHFPROC) (GLfloat d); -typedef void (APIENTRYP PFNGLGETPROGRAMBINARYPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLenum *binaryFormat, GLvoid *binary); -typedef void (APIENTRYP PFNGLPROGRAMBINARYPROC) (GLuint program, GLenum binaryFormat, const GLvoid *binary, GLsizei length); +typedef void (APIENTRYP PFNGLGETPROGRAMBINARYPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLenum *binaryFormat, void *binary); +typedef void (APIENTRYP PFNGLPROGRAMBINARYPROC) (GLuint program, GLenum binaryFormat, const void *binary, GLsizei length); typedef void (APIENTRYP PFNGLPROGRAMPARAMETERIPROC) (GLuint program, GLenum pname, GLint value); typedef void (APIENTRYP PFNGLUSEPROGRAMSTAGESPROC) (GLuint pipeline, GLbitfield stages, GLuint program); typedef void (APIENTRYP PFNGLACTIVESHADERPROGRAMPROC) (GLuint pipeline, GLuint program); @@ -1926,7 +1935,7 @@ typedef void (APIENTRYP PFNGLVERTEXATTRIBL1DVPROC) (GLuint index, const GLdouble typedef void (APIENTRYP PFNGLVERTEXATTRIBL2DVPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBL3DVPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBL4DVPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBLPOINTERPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXATTRIBLPOINTERPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBLDVPROC) (GLuint index, GLenum pname, GLdouble *params); typedef void (APIENTRYP PFNGLVIEWPORTARRAYVPROC) (GLuint first, GLsizei count, const GLfloat *v); typedef void (APIENTRYP PFNGLVIEWPORTINDEXEDFPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat w, GLfloat h); @@ -1940,12 +1949,12 @@ typedef void (APIENTRYP PFNGLGETFLOATI_VPROC) (GLenum target, GLuint index, GLfl typedef void (APIENTRYP PFNGLGETDOUBLEI_VPROC) (GLenum target, GLuint index, GLdouble *data); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glReleaseShaderCompiler (void); -GLAPI void APIENTRY glShaderBinary (GLsizei count, const GLuint *shaders, GLenum binaryformat, const GLvoid *binary, GLsizei length); +GLAPI void APIENTRY glShaderBinary (GLsizei count, const GLuint *shaders, GLenum binaryformat, const void *binary, GLsizei length); GLAPI void APIENTRY glGetShaderPrecisionFormat (GLenum shadertype, GLenum precisiontype, GLint *range, GLint *precision); GLAPI void APIENTRY glDepthRangef (GLfloat n, GLfloat f); GLAPI void APIENTRY glClearDepthf (GLfloat d); -GLAPI void APIENTRY glGetProgramBinary (GLuint program, GLsizei bufSize, GLsizei *length, GLenum *binaryFormat, GLvoid *binary); -GLAPI void APIENTRY glProgramBinary (GLuint program, GLenum binaryFormat, const GLvoid *binary, GLsizei length); +GLAPI void APIENTRY glGetProgramBinary (GLuint program, GLsizei bufSize, GLsizei *length, GLenum *binaryFormat, void *binary); +GLAPI void APIENTRY glProgramBinary (GLuint program, GLenum binaryFormat, const void *binary, GLsizei length); GLAPI void APIENTRY glProgramParameteri (GLuint program, GLenum pname, GLint value); GLAPI void APIENTRY glUseProgramStages (GLuint pipeline, GLbitfield stages, GLuint program); GLAPI void APIENTRY glActiveShaderProgram (GLuint pipeline, GLuint program); @@ -2015,7 +2024,7 @@ GLAPI void APIENTRY glVertexAttribL1dv (GLuint index, const GLdouble *v); GLAPI void APIENTRY glVertexAttribL2dv (GLuint index, const GLdouble *v); GLAPI void APIENTRY glVertexAttribL3dv (GLuint index, const GLdouble *v); GLAPI void APIENTRY glVertexAttribL4dv (GLuint index, const GLdouble *v); -GLAPI void APIENTRY glVertexAttribLPointer (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glVertexAttribLPointer (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); GLAPI void APIENTRY glGetVertexAttribLdv (GLuint index, GLenum pname, GLdouble *params); GLAPI void APIENTRY glViewportArrayv (GLuint first, GLsizei count, const GLfloat *v); GLAPI void APIENTRY glViewportIndexedf (GLuint index, GLfloat x, GLfloat y, GLfloat w, GLfloat h); @@ -2139,7 +2148,7 @@ GLAPI void APIENTRY glGetDoublei_v (GLenum target, GLuint index, GLdouble *data) typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance); typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance); typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance); -typedef void (APIENTRYP PFNGLGETINTERNALFORMATI64VPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64 *params); +typedef void (APIENTRYP PFNGLGETINTERNALFORMATIVPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint *params); typedef void (APIENTRYP PFNGLGETACTIVEATOMICCOUNTERBUFFERIVPROC) (GLuint program, GLuint bufferIndex, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLBINDIMAGETEXTUREPROC) (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format); typedef void (APIENTRYP PFNGLMEMORYBARRIERPROC) (GLbitfield barriers); @@ -2152,7 +2161,7 @@ typedef void (APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKSTREAMINSTANCEDPROC) (GLenum m GLAPI void APIENTRY glDrawArraysInstancedBaseInstance (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance); GLAPI void APIENTRY glDrawElementsInstancedBaseInstance (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance); GLAPI void APIENTRY glDrawElementsInstancedBaseVertexBaseInstance (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance); -GLAPI void APIENTRY glGetInternalformati64v (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64 *params); +GLAPI void APIENTRY glGetInternalformativ (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint *params); GLAPI void APIENTRY glGetActiveAtomicCounterBufferiv (GLuint program, GLuint bufferIndex, GLenum pname, GLint *params); GLAPI void APIENTRY glBindImageTexture (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format); GLAPI void APIENTRY glMemoryBarrier (GLbitfield barriers); @@ -2191,10 +2200,10 @@ typedef void (APIENTRY *GLDEBUGPROC)(GLenum source,GLenum type,GLuint id,GLenum #define GL_MAX_COMPUTE_ATOMIC_COUNTER_BUFFERS 0x8264 #define GL_MAX_COMPUTE_ATOMIC_COUNTERS 0x8265 #define GL_MAX_COMBINED_COMPUTE_UNIFORM_COMPONENTS 0x8266 -#define GL_MAX_COMPUTE_LOCAL_INVOCATIONS 0x90EB +#define GL_MAX_COMPUTE_WORK_GROUP_INVOCATIONS 0x90EB #define GL_MAX_COMPUTE_WORK_GROUP_COUNT 0x91BE #define GL_MAX_COMPUTE_WORK_GROUP_SIZE 0x91BF -#define GL_COMPUTE_LOCAL_WORK_SIZE 0x8267 +#define GL_COMPUTE_WORK_GROUP_SIZE 0x8267 #define GL_UNIFORM_BLOCK_REFERENCED_BY_COMPUTE_SHADER 0x90EC #define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_COMPUTE_SHADER 0x90ED #define GL_DISPATCH_INDIRECT_BUFFER 0x90EE @@ -2431,6 +2440,7 @@ typedef void (APIENTRYP PFNGLDISPATCHCOMPUTEINDIRECTPROC) (GLintptr indirect); typedef void (APIENTRYP PFNGLCOPYIMAGESUBDATAPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); typedef void (APIENTRYP PFNGLFRAMEBUFFERPARAMETERIPROC) (GLenum target, GLenum pname, GLint param); typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETINTERNALFORMATI64VPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64 *params); typedef void (APIENTRYP PFNGLINVALIDATETEXSUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth); typedef void (APIENTRYP PFNGLINVALIDATETEXIMAGEPROC) (GLuint texture, GLint level); typedef void (APIENTRYP PFNGLINVALIDATEBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length); @@ -2459,7 +2469,7 @@ typedef void (APIENTRYP PFNGLVERTEXBINDINGDIVISORPROC) (GLuint bindingindex, GLu typedef void (APIENTRYP PFNGLDEBUGMESSAGECONTROLPROC) (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); typedef void (APIENTRYP PFNGLDEBUGMESSAGEINSERTPROC) (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); typedef void (APIENTRYP PFNGLDEBUGMESSAGECALLBACKPROC) (GLDEBUGPROC callback, const void *userParam); -typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGPROC) (GLuint count, GLsizei bufsize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGPROC) (GLuint count, GLsizei bufSize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); typedef void (APIENTRYP PFNGLPUSHDEBUGGROUPPROC) (GLenum source, GLuint id, GLsizei length, const GLchar *message); typedef void (APIENTRYP PFNGLPOPDEBUGGROUPPROC) (void); typedef void (APIENTRYP PFNGLOBJECTLABELPROC) (GLenum identifier, GLuint name, GLsizei length, const GLchar *label); @@ -2474,6 +2484,7 @@ GLAPI void APIENTRY glDispatchComputeIndirect (GLintptr indirect); GLAPI void APIENTRY glCopyImageSubData (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); GLAPI void APIENTRY glFramebufferParameteri (GLenum target, GLenum pname, GLint param); GLAPI void APIENTRY glGetFramebufferParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetInternalformati64v (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64 *params); GLAPI void APIENTRY glInvalidateTexSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth); GLAPI void APIENTRY glInvalidateTexImage (GLuint texture, GLint level); GLAPI void APIENTRY glInvalidateBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr length); @@ -2502,7 +2513,7 @@ GLAPI void APIENTRY glVertexBindingDivisor (GLuint bindingindex, GLuint divisor) GLAPI void APIENTRY glDebugMessageControl (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); GLAPI void APIENTRY glDebugMessageInsert (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); GLAPI void APIENTRY glDebugMessageCallback (GLDEBUGPROC callback, const void *userParam); -GLAPI GLuint APIENTRY glGetDebugMessageLog (GLuint count, GLsizei bufsize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +GLAPI GLuint APIENTRY glGetDebugMessageLog (GLuint count, GLsizei bufSize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); GLAPI void APIENTRY glPushDebugGroup (GLenum source, GLuint id, GLsizei length, const GLchar *message); GLAPI void APIENTRY glPopDebugGroup (void); GLAPI void APIENTRY glObjectLabel (GLenum identifier, GLuint name, GLsizei length, const GLchar *label); @@ -2515,6 +2526,8 @@ GLAPI void APIENTRY glGetObjectPtrLabel (const void *ptr, GLsizei bufSize, GLsiz #ifndef GL_VERSION_4_4 #define GL_VERSION_4_4 1 #define GL_MAX_VERTEX_ATTRIB_STRIDE 0x82E5 +#define GL_PRIMITIVE_RESTART_FOR_PATCHES_SUPPORTED 0x8221 +#define GL_TEXTURE_BUFFER_BINDING 0x8C2A #define GL_MAP_PERSISTENT_BIT 0x0040 #define GL_MAP_COHERENT_BIT 0x0080 #define GL_DYNAMIC_STORAGE_BIT 0x0100 @@ -2717,12 +2730,12 @@ typedef void (APIENTRY *GLDEBUGPROCARB)(GLenum source,GLenum type,GLuint id,GLe typedef void (APIENTRYP PFNGLDEBUGMESSAGECONTROLARBPROC) (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); typedef void (APIENTRYP PFNGLDEBUGMESSAGEINSERTARBPROC) (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); typedef void (APIENTRYP PFNGLDEBUGMESSAGECALLBACKARBPROC) (GLDEBUGPROCARB callback, const void *userParam); -typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGARBPROC) (GLuint count, GLsizei bufsize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGARBPROC) (GLuint count, GLsizei bufSize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDebugMessageControlARB (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); GLAPI void APIENTRY glDebugMessageInsertARB (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); GLAPI void APIENTRY glDebugMessageCallbackARB (GLDEBUGPROCARB callback, const void *userParam); -GLAPI GLuint APIENTRY glGetDebugMessageLogARB (GLuint count, GLsizei bufsize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +GLAPI GLuint APIENTRY glGetDebugMessageLogARB (GLuint count, GLsizei bufSize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); #endif #endif /* GL_ARB_debug_output */ @@ -2793,10 +2806,10 @@ GLAPI void APIENTRY glBlendFuncSeparateiARB (GLuint buf, GLenum srcRGB, GLenum d #ifndef GL_ARB_draw_instanced #define GL_ARB_draw_instanced 1 typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDARBPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount); -typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDARBPROC) (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDARBPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDrawArraysInstancedARB (GLenum mode, GLint first, GLsizei count, GLsizei primcount); -GLAPI void APIENTRY glDrawElementsInstancedARB (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount); +GLAPI void APIENTRY glDrawElementsInstancedARB (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); #endif #endif /* GL_ARB_draw_instanced */ @@ -2900,7 +2913,7 @@ GLAPI void APIENTRY glDrawElementsInstancedARB (GLenum mode, GLsizei count, GLen #define GL_MATRIX29_ARB 0x88DD #define GL_MATRIX30_ARB 0x88DE #define GL_MATRIX31_ARB 0x88DF -typedef void (APIENTRYP PFNGLPROGRAMSTRINGARBPROC) (GLenum target, GLenum format, GLsizei len, const GLvoid *string); +typedef void (APIENTRYP PFNGLPROGRAMSTRINGARBPROC) (GLenum target, GLenum format, GLsizei len, const void *string); typedef void (APIENTRYP PFNGLBINDPROGRAMARBPROC) (GLenum target, GLuint program); typedef void (APIENTRYP PFNGLDELETEPROGRAMSARBPROC) (GLsizei n, const GLuint *programs); typedef void (APIENTRYP PFNGLGENPROGRAMSARBPROC) (GLsizei n, GLuint *programs); @@ -2917,10 +2930,10 @@ typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERFVARBPROC) (GLenum target, GL typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params); typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params); typedef void (APIENTRYP PFNGLGETPROGRAMIVARBPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGARBPROC) (GLenum target, GLenum pname, GLvoid *string); +typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGARBPROC) (GLenum target, GLenum pname, void *string); typedef GLboolean (APIENTRYP PFNGLISPROGRAMARBPROC) (GLuint program); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glProgramStringARB (GLenum target, GLenum format, GLsizei len, const GLvoid *string); +GLAPI void APIENTRY glProgramStringARB (GLenum target, GLenum format, GLsizei len, const void *string); GLAPI void APIENTRY glBindProgramARB (GLenum target, GLuint program); GLAPI void APIENTRY glDeleteProgramsARB (GLsizei n, const GLuint *programs); GLAPI void APIENTRY glGenProgramsARB (GLsizei n, GLuint *programs); @@ -2937,7 +2950,7 @@ GLAPI void APIENTRY glGetProgramEnvParameterfvARB (GLenum target, GLuint index, GLAPI void APIENTRY glGetProgramLocalParameterdvARB (GLenum target, GLuint index, GLdouble *params); GLAPI void APIENTRY glGetProgramLocalParameterfvARB (GLenum target, GLuint index, GLfloat *params); GLAPI void APIENTRY glGetProgramivARB (GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetProgramStringARB (GLenum target, GLenum pname, GLvoid *string); +GLAPI void APIENTRY glGetProgramStringARB (GLenum target, GLenum pname, void *string); GLAPI GLboolean APIENTRY glIsProgramARB (GLuint program); #endif #endif /* GL_ARB_fragment_program */ @@ -3021,17 +3034,8 @@ typedef unsigned short GLhalfARB; #ifndef GL_ARB_imaging #define GL_ARB_imaging 1 -#define GL_CONSTANT_COLOR 0x8001 -#define GL_ONE_MINUS_CONSTANT_COLOR 0x8002 -#define GL_CONSTANT_ALPHA 0x8003 -#define GL_ONE_MINUS_CONSTANT_ALPHA 0x8004 #define GL_BLEND_COLOR 0x8005 -#define GL_FUNC_ADD 0x8006 -#define GL_MIN 0x8007 -#define GL_MAX 0x8008 #define GL_BLEND_EQUATION 0x8009 -#define GL_FUNC_SUBTRACT 0x800A -#define GL_FUNC_REVERSE_SUBTRACT 0x800B #define GL_CONVOLUTION_1D 0x8010 #define GL_CONVOLUTION_2D 0x8011 #define GL_SEPARABLE_2D 0x8012 @@ -3096,32 +3100,32 @@ typedef unsigned short GLhalfARB; #define GL_CONSTANT_BORDER 0x8151 #define GL_REPLICATE_BORDER 0x8153 #define GL_CONVOLUTION_BORDER_COLOR 0x8154 -typedef void (APIENTRYP PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); +typedef void (APIENTRYP PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *table); typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLCOPYCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); -typedef void (APIENTRYP PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, void *table); typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const void *data); typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); -typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); -typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *image); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat params); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIPROC) (GLenum target, GLenum pname, GLint params); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); -typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, void *image); typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); -typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); -typedef void (APIENTRYP PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +typedef void (APIENTRYP PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, void *row, void *column, void *span); +typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *row, const void *column); +typedef void (APIENTRYP PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +typedef void (APIENTRYP PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLHISTOGRAMPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); @@ -3129,32 +3133,32 @@ typedef void (APIENTRYP PFNGLMINMAXPROC) (GLenum target, GLenum internalformat, typedef void (APIENTRYP PFNGLRESETHISTOGRAMPROC) (GLenum target); typedef void (APIENTRYP PFNGLRESETMINMAXPROC) (GLenum target); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorTable (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); +GLAPI void APIENTRY glColorTable (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *table); GLAPI void APIENTRY glColorTableParameterfv (GLenum target, GLenum pname, const GLfloat *params); GLAPI void APIENTRY glColorTableParameteriv (GLenum target, GLenum pname, const GLint *params); GLAPI void APIENTRY glCopyColorTable (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); -GLAPI void APIENTRY glGetColorTable (GLenum target, GLenum format, GLenum type, GLvoid *table); +GLAPI void APIENTRY glGetColorTable (GLenum target, GLenum format, GLenum type, void *table); GLAPI void APIENTRY glGetColorTableParameterfv (GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetColorTableParameteriv (GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glColorSubTable (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); +GLAPI void APIENTRY glColorSubTable (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const void *data); GLAPI void APIENTRY glCopyColorSubTable (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); -GLAPI void APIENTRY glConvolutionFilter1D (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); -GLAPI void APIENTRY glConvolutionFilter2D (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); +GLAPI void APIENTRY glConvolutionFilter1D (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *image); +GLAPI void APIENTRY glConvolutionFilter2D (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *image); GLAPI void APIENTRY glConvolutionParameterf (GLenum target, GLenum pname, GLfloat params); GLAPI void APIENTRY glConvolutionParameterfv (GLenum target, GLenum pname, const GLfloat *params); GLAPI void APIENTRY glConvolutionParameteri (GLenum target, GLenum pname, GLint params); GLAPI void APIENTRY glConvolutionParameteriv (GLenum target, GLenum pname, const GLint *params); GLAPI void APIENTRY glCopyConvolutionFilter1D (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); GLAPI void APIENTRY glCopyConvolutionFilter2D (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); -GLAPI void APIENTRY glGetConvolutionFilter (GLenum target, GLenum format, GLenum type, GLvoid *image); +GLAPI void APIENTRY glGetConvolutionFilter (GLenum target, GLenum format, GLenum type, void *image); GLAPI void APIENTRY glGetConvolutionParameterfv (GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetConvolutionParameteriv (GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetSeparableFilter (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); -GLAPI void APIENTRY glSeparableFilter2D (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); -GLAPI void APIENTRY glGetHistogram (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +GLAPI void APIENTRY glGetSeparableFilter (GLenum target, GLenum format, GLenum type, void *row, void *column, void *span); +GLAPI void APIENTRY glSeparableFilter2D (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *row, const void *column); +GLAPI void APIENTRY glGetHistogram (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); GLAPI void APIENTRY glGetHistogramParameterfv (GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetHistogramParameteriv (GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetMinmax (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +GLAPI void APIENTRY glGetMinmax (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); GLAPI void APIENTRY glGetMinmaxParameterfv (GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetMinmaxParameteriv (GLenum target, GLenum pname, GLint *params); GLAPI void APIENTRY glHistogram (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); @@ -3187,10 +3191,6 @@ GLAPI void APIENTRY glVertexAttribDivisorARB (GLuint index, GLuint divisor); #ifndef GL_ARB_internalformat_query #define GL_ARB_internalformat_query 1 -typedef void (APIENTRYP PFNGLGETINTERNALFORMATIVPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint *params); -#ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGetInternalformativ (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint *params); -#endif #endif /* GL_ARB_internalformat_query */ #ifndef GL_ARB_internalformat_query2 @@ -3226,13 +3226,13 @@ typedef void (APIENTRYP PFNGLCURRENTPALETTEMATRIXARBPROC) (GLint index); typedef void (APIENTRYP PFNGLMATRIXINDEXUBVARBPROC) (GLint size, const GLubyte *indices); typedef void (APIENTRYP PFNGLMATRIXINDEXUSVARBPROC) (GLint size, const GLushort *indices); typedef void (APIENTRYP PFNGLMATRIXINDEXUIVARBPROC) (GLint size, const GLuint *indices); -typedef void (APIENTRYP PFNGLMATRIXINDEXPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLMATRIXINDEXPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const void *pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glCurrentPaletteMatrixARB (GLint index); GLAPI void APIENTRY glMatrixIndexubvARB (GLint size, const GLubyte *indices); GLAPI void APIENTRY glMatrixIndexusvARB (GLint size, const GLushort *indices); GLAPI void APIENTRY glMatrixIndexuivARB (GLint size, const GLuint *indices); -GLAPI void APIENTRY glMatrixIndexPointerARB (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glMatrixIndexPointerARB (GLint size, GLenum type, GLsizei stride, const void *pointer); #endif #endif /* GL_ARB_matrix_palette */ @@ -3455,9 +3455,9 @@ GLAPI void APIENTRY glPointParameterfvARB (GLenum pname, const GLfloat *params); #define GL_RESET_NOTIFICATION_STRATEGY_ARB 0x8256 #define GL_NO_RESET_NOTIFICATION_ARB 0x8261 typedef GLenum (APIENTRYP PFNGLGETGRAPHICSRESETSTATUSARBPROC) (void); -typedef void (APIENTRYP PFNGLGETNTEXIMAGEARBPROC) (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, GLvoid *img); -typedef void (APIENTRYP PFNGLREADNPIXELSARBPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, GLvoid *data); -typedef void (APIENTRYP PFNGLGETNCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint lod, GLsizei bufSize, GLvoid *img); +typedef void (APIENTRYP PFNGLGETNTEXIMAGEARBPROC) (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *img); +typedef void (APIENTRYP PFNGLREADNPIXELSARBPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +typedef void (APIENTRYP PFNGLGETNCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint lod, GLsizei bufSize, void *img); typedef void (APIENTRYP PFNGLGETNUNIFORMFVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); typedef void (APIENTRYP PFNGLGETNUNIFORMIVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLint *params); typedef void (APIENTRYP PFNGLGETNUNIFORMUIVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint *params); @@ -3469,16 +3469,16 @@ typedef void (APIENTRYP PFNGLGETNPIXELMAPFVARBPROC) (GLenum map, GLsizei bufSize typedef void (APIENTRYP PFNGLGETNPIXELMAPUIVARBPROC) (GLenum map, GLsizei bufSize, GLuint *values); typedef void (APIENTRYP PFNGLGETNPIXELMAPUSVARBPROC) (GLenum map, GLsizei bufSize, GLushort *values); typedef void (APIENTRYP PFNGLGETNPOLYGONSTIPPLEARBPROC) (GLsizei bufSize, GLubyte *pattern); -typedef void (APIENTRYP PFNGLGETNCOLORTABLEARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, GLvoid *table); -typedef void (APIENTRYP PFNGLGETNCONVOLUTIONFILTERARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, GLvoid *image); -typedef void (APIENTRYP PFNGLGETNSEPARABLEFILTERARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, GLvoid *row, GLsizei columnBufSize, GLvoid *column, GLvoid *span); -typedef void (APIENTRYP PFNGLGETNHISTOGRAMARBPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, GLvoid *values); -typedef void (APIENTRYP PFNGLGETNMINMAXARBPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, GLvoid *values); +typedef void (APIENTRYP PFNGLGETNCOLORTABLEARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *table); +typedef void (APIENTRYP PFNGLGETNCONVOLUTIONFILTERARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *image); +typedef void (APIENTRYP PFNGLGETNSEPARABLEFILTERARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, void *row, GLsizei columnBufSize, void *column, void *span); +typedef void (APIENTRYP PFNGLGETNHISTOGRAMARBPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +typedef void (APIENTRYP PFNGLGETNMINMAXARBPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); #ifdef GL_GLEXT_PROTOTYPES GLAPI GLenum APIENTRY glGetGraphicsResetStatusARB (void); -GLAPI void APIENTRY glGetnTexImageARB (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, GLvoid *img); -GLAPI void APIENTRY glReadnPixelsARB (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, GLvoid *data); -GLAPI void APIENTRY glGetnCompressedTexImageARB (GLenum target, GLint lod, GLsizei bufSize, GLvoid *img); +GLAPI void APIENTRY glGetnTexImageARB (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *img); +GLAPI void APIENTRY glReadnPixelsARB (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +GLAPI void APIENTRY glGetnCompressedTexImageARB (GLenum target, GLint lod, GLsizei bufSize, void *img); GLAPI void APIENTRY glGetnUniformfvARB (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); GLAPI void APIENTRY glGetnUniformivARB (GLuint program, GLint location, GLsizei bufSize, GLint *params); GLAPI void APIENTRY glGetnUniformuivARB (GLuint program, GLint location, GLsizei bufSize, GLuint *params); @@ -3490,11 +3490,11 @@ GLAPI void APIENTRY glGetnPixelMapfvARB (GLenum map, GLsizei bufSize, GLfloat *v GLAPI void APIENTRY glGetnPixelMapuivARB (GLenum map, GLsizei bufSize, GLuint *values); GLAPI void APIENTRY glGetnPixelMapusvARB (GLenum map, GLsizei bufSize, GLushort *values); GLAPI void APIENTRY glGetnPolygonStippleARB (GLsizei bufSize, GLubyte *pattern); -GLAPI void APIENTRY glGetnColorTableARB (GLenum target, GLenum format, GLenum type, GLsizei bufSize, GLvoid *table); -GLAPI void APIENTRY glGetnConvolutionFilterARB (GLenum target, GLenum format, GLenum type, GLsizei bufSize, GLvoid *image); -GLAPI void APIENTRY glGetnSeparableFilterARB (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, GLvoid *row, GLsizei columnBufSize, GLvoid *column, GLvoid *span); -GLAPI void APIENTRY glGetnHistogramARB (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, GLvoid *values); -GLAPI void APIENTRY glGetnMinmaxARB (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, GLvoid *values); +GLAPI void APIENTRY glGetnColorTableARB (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *table); +GLAPI void APIENTRY glGetnConvolutionFilterARB (GLenum target, GLenum format, GLenum type, GLsizei bufSize, void *image); +GLAPI void APIENTRY glGetnSeparableFilterARB (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, void *row, GLsizei columnBufSize, void *column, void *span); +GLAPI void APIENTRY glGetnHistogramARB (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); +GLAPI void APIENTRY glGetnMinmaxARB (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, void *values); #endif #endif /* GL_ARB_robustness */ @@ -3812,21 +3812,21 @@ GLAPI void APIENTRY glTexBufferARB (GLenum target, GLenum internalformat, GLuint #define GL_TEXTURE_COMPRESSED_ARB 0x86A1 #define GL_NUM_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A2 #define GL_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A3 -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); -typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint level, GLvoid *img); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint level, void *img); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glCompressedTexImage3DARB (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexImage2DARB (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexImage1DARB (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexSubImage3DARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexSubImage2DARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glCompressedTexSubImage1DARB (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); -GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum target, GLint level, GLvoid *img); +GLAPI void APIENTRY glCompressedTexImage3DARB (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexImage2DARB (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexImage1DARB (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage3DARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage2DARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage1DARB (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum target, GLint level, void *img); #endif #endif /* GL_ARB_texture_compression */ @@ -4112,7 +4112,7 @@ typedef void (APIENTRYP PFNGLWEIGHTDVARBPROC) (GLint size, const GLdouble *weigh typedef void (APIENTRYP PFNGLWEIGHTUBVARBPROC) (GLint size, const GLubyte *weights); typedef void (APIENTRYP PFNGLWEIGHTUSVARBPROC) (GLint size, const GLushort *weights); typedef void (APIENTRYP PFNGLWEIGHTUIVARBPROC) (GLint size, const GLuint *weights); -typedef void (APIENTRYP PFNGLWEIGHTPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLWEIGHTPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLVERTEXBLENDARBPROC) (GLint count); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glWeightbvARB (GLint size, const GLbyte *weights); @@ -4123,15 +4123,23 @@ GLAPI void APIENTRY glWeightdvARB (GLint size, const GLdouble *weights); GLAPI void APIENTRY glWeightubvARB (GLint size, const GLubyte *weights); GLAPI void APIENTRY glWeightusvARB (GLint size, const GLushort *weights); GLAPI void APIENTRY glWeightuivARB (GLint size, const GLuint *weights); -GLAPI void APIENTRY glWeightPointerARB (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glWeightPointerARB (GLint size, GLenum type, GLsizei stride, const void *pointer); GLAPI void APIENTRY glVertexBlendARB (GLint count); #endif #endif /* GL_ARB_vertex_blend */ #ifndef GL_ARB_vertex_buffer_object #define GL_ARB_vertex_buffer_object 1 +/* HACK: This is a workaround for gltypes.h on OS X 10.9 defining these types as + * long instead of ptrdiff_t + */ +#if defined(__APPLE__) +typedef long GLsizeiptrARB; +typedef long GLintptrARB; +#else typedef ptrdiff_t GLsizeiptrARB; typedef ptrdiff_t GLintptrARB; +#endif #define GL_BUFFER_SIZE_ARB 0x8764 #define GL_BUFFER_USAGE_ARB 0x8765 #define GL_ARRAY_BUFFER_ARB 0x8892 @@ -4167,25 +4175,25 @@ typedef void (APIENTRYP PFNGLBINDBUFFERARBPROC) (GLenum target, GLuint buffer); typedef void (APIENTRYP PFNGLDELETEBUFFERSARBPROC) (GLsizei n, const GLuint *buffers); typedef void (APIENTRYP PFNGLGENBUFFERSARBPROC) (GLsizei n, GLuint *buffers); typedef GLboolean (APIENTRYP PFNGLISBUFFERARBPROC) (GLuint buffer); -typedef void (APIENTRYP PFNGLBUFFERDATAARBPROC) (GLenum target, GLsizeiptrARB size, const GLvoid *data, GLenum usage); -typedef void (APIENTRYP PFNGLBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid *data); -typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, GLvoid *data); +typedef void (APIENTRYP PFNGLBUFFERDATAARBPROC) (GLenum target, GLsizeiptrARB size, const void *data, GLenum usage); +typedef void (APIENTRYP PFNGLBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const void *data); +typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, void *data); typedef void *(APIENTRYP PFNGLMAPBUFFERARBPROC) (GLenum target, GLenum access); typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERARBPROC) (GLenum target); typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVARBPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVARBPROC) (GLenum target, GLenum pname, GLvoid **params); +typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVARBPROC) (GLenum target, GLenum pname, void **params); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glBindBufferARB (GLenum target, GLuint buffer); GLAPI void APIENTRY glDeleteBuffersARB (GLsizei n, const GLuint *buffers); GLAPI void APIENTRY glGenBuffersARB (GLsizei n, GLuint *buffers); GLAPI GLboolean APIENTRY glIsBufferARB (GLuint buffer); -GLAPI void APIENTRY glBufferDataARB (GLenum target, GLsizeiptrARB size, const GLvoid *data, GLenum usage); -GLAPI void APIENTRY glBufferSubDataARB (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid *data); -GLAPI void APIENTRY glGetBufferSubDataARB (GLenum target, GLintptrARB offset, GLsizeiptrARB size, GLvoid *data); +GLAPI void APIENTRY glBufferDataARB (GLenum target, GLsizeiptrARB size, const void *data, GLenum usage); +GLAPI void APIENTRY glBufferSubDataARB (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const void *data); +GLAPI void APIENTRY glGetBufferSubDataARB (GLenum target, GLintptrARB offset, GLsizeiptrARB size, void *data); GLAPI void *APIENTRY glMapBufferARB (GLenum target, GLenum access); GLAPI GLboolean APIENTRY glUnmapBufferARB (GLenum target); GLAPI void APIENTRY glGetBufferParameterivARB (GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetBufferPointervARB (GLenum target, GLenum pname, GLvoid **params); +GLAPI void APIENTRY glGetBufferPointervARB (GLenum target, GLenum pname, void **params); #endif #endif /* GL_ARB_vertex_buffer_object */ @@ -4243,13 +4251,13 @@ typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVARBPROC) (GLuint index, const GLshor typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVARBPROC) (GLuint index, const GLubyte *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVARBPROC) (GLuint index, const GLuint *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVARBPROC) (GLuint index, const GLushort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERARBPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERARBPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYARBPROC) (GLuint index); typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYARBPROC) (GLuint index); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVARBPROC) (GLuint index, GLenum pname, GLdouble *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVARBPROC) (GLuint index, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVARBPROC) (GLuint index, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVARBPROC) (GLuint index, GLenum pname, GLvoid **pointer); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVARBPROC) (GLuint index, GLenum pname, void **pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glVertexAttrib1dARB (GLuint index, GLdouble x); GLAPI void APIENTRY glVertexAttrib1dvARB (GLuint index, const GLdouble *v); @@ -4287,13 +4295,13 @@ GLAPI void APIENTRY glVertexAttrib4svARB (GLuint index, const GLshort *v); GLAPI void APIENTRY glVertexAttrib4ubvARB (GLuint index, const GLubyte *v); GLAPI void APIENTRY glVertexAttrib4uivARB (GLuint index, const GLuint *v); GLAPI void APIENTRY glVertexAttrib4usvARB (GLuint index, const GLushort *v); -GLAPI void APIENTRY glVertexAttribPointerARB (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glVertexAttribPointerARB (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void *pointer); GLAPI void APIENTRY glEnableVertexAttribArrayARB (GLuint index); GLAPI void APIENTRY glDisableVertexAttribArrayARB (GLuint index); GLAPI void APIENTRY glGetVertexAttribdvARB (GLuint index, GLenum pname, GLdouble *params); GLAPI void APIENTRY glGetVertexAttribfvARB (GLuint index, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetVertexAttribivARB (GLuint index, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetVertexAttribPointervARB (GLuint index, GLenum pname, GLvoid **pointer); +GLAPI void APIENTRY glGetVertexAttribPointervARB (GLuint index, GLenum pname, void **pointer); #endif #endif /* GL_ARB_vertex_program */ @@ -4370,8 +4378,8 @@ GLAPI void APIENTRY glWindowPos3svARB (const GLshort *v); #define GL_KHR_debug 1 #endif /* GL_KHR_debug */ -#ifndef GL_KHR_texture_compression_astc_ldr -#define GL_KHR_texture_compression_astc_ldr 1 +#ifndef GL_KHR_texture_compression_astc_hdr +#define GL_KHR_texture_compression_astc_hdr 1 #define GL_COMPRESSED_RGBA_ASTC_4x4_KHR 0x93B0 #define GL_COMPRESSED_RGBA_ASTC_5x4_KHR 0x93B1 #define GL_COMPRESSED_RGBA_ASTC_5x5_KHR 0x93B2 @@ -4400,6 +4408,10 @@ GLAPI void APIENTRY glWindowPos3svARB (const GLshort *v); #define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_10x10_KHR 0x93DB #define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_12x10_KHR 0x93DC #define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_12x12_KHR 0x93DD +#endif /* GL_KHR_texture_compression_astc_hdr */ + +#ifndef GL_KHR_texture_compression_astc_ldr +#define GL_KHR_texture_compression_astc_ldr 1 #endif /* GL_KHR_texture_compression_astc_ldr */ #ifndef GL_OES_byte_coordinates @@ -4807,11 +4819,11 @@ GLAPI void APIENTRY glVertexAttribParameteriAMD (GLuint index, GLenum pname, GLi #ifndef GL_AMD_multi_draw_indirect #define GL_AMD_multi_draw_indirect 1 -typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTAMDPROC) (GLenum mode, const GLvoid *indirect, GLsizei primcount, GLsizei stride); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTAMDPROC) (GLenum mode, GLenum type, const GLvoid *indirect, GLsizei primcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTAMDPROC) (GLenum mode, const void *indirect, GLsizei primcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTAMDPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei primcount, GLsizei stride); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glMultiDrawArraysIndirectAMD (GLenum mode, const GLvoid *indirect, GLsizei primcount, GLsizei stride); -GLAPI void APIENTRY glMultiDrawElementsIndirectAMD (GLenum mode, GLenum type, const GLvoid *indirect, GLsizei primcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawArraysIndirectAMD (GLenum mode, const void *indirect, GLsizei primcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawElementsIndirectAMD (GLenum mode, GLenum type, const void *indirect, GLsizei primcount, GLsizei stride); #endif #endif /* GL_AMD_multi_draw_indirect */ @@ -4845,7 +4857,7 @@ typedef void (APIENTRYP PFNGLGETPERFMONITORGROUPSAMDPROC) (GLint *numGroups, GLs typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERSAMDPROC) (GLuint group, GLint *numCounters, GLint *maxActiveCounters, GLsizei counterSize, GLuint *counters); typedef void (APIENTRYP PFNGLGETPERFMONITORGROUPSTRINGAMDPROC) (GLuint group, GLsizei bufSize, GLsizei *length, GLchar *groupString); typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERSTRINGAMDPROC) (GLuint group, GLuint counter, GLsizei bufSize, GLsizei *length, GLchar *counterString); -typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERINFOAMDPROC) (GLuint group, GLuint counter, GLenum pname, GLvoid *data); +typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERINFOAMDPROC) (GLuint group, GLuint counter, GLenum pname, void *data); typedef void (APIENTRYP PFNGLGENPERFMONITORSAMDPROC) (GLsizei n, GLuint *monitors); typedef void (APIENTRYP PFNGLDELETEPERFMONITORSAMDPROC) (GLsizei n, GLuint *monitors); typedef void (APIENTRYP PFNGLSELECTPERFMONITORCOUNTERSAMDPROC) (GLuint monitor, GLboolean enable, GLuint group, GLint numCounters, GLuint *counterList); @@ -4857,7 +4869,7 @@ GLAPI void APIENTRY glGetPerfMonitorGroupsAMD (GLint *numGroups, GLsizei groupsS GLAPI void APIENTRY glGetPerfMonitorCountersAMD (GLuint group, GLint *numCounters, GLint *maxActiveCounters, GLsizei counterSize, GLuint *counters); GLAPI void APIENTRY glGetPerfMonitorGroupStringAMD (GLuint group, GLsizei bufSize, GLsizei *length, GLchar *groupString); GLAPI void APIENTRY glGetPerfMonitorCounterStringAMD (GLuint group, GLuint counter, GLsizei bufSize, GLsizei *length, GLchar *counterString); -GLAPI void APIENTRY glGetPerfMonitorCounterInfoAMD (GLuint group, GLuint counter, GLenum pname, GLvoid *data); +GLAPI void APIENTRY glGetPerfMonitorCounterInfoAMD (GLuint group, GLuint counter, GLenum pname, void *data); GLAPI void APIENTRY glGenPerfMonitorsAMD (GLsizei n, GLuint *monitors); GLAPI void APIENTRY glDeletePerfMonitorsAMD (GLsizei n, GLuint *monitors); GLAPI void APIENTRY glSelectPerfMonitorCountersAMD (GLuint monitor, GLboolean enable, GLuint group, GLint numCounters, GLuint *counterList); @@ -4892,6 +4904,10 @@ GLAPI void APIENTRY glSetMultisamplefvAMD (GLenum pname, GLuint index, const GLf #define GL_AMD_seamless_cubemap_per_texture 1 #endif /* GL_AMD_seamless_cubemap_per_texture */ +#ifndef GL_AMD_shader_atomic_counter_ops +#define GL_AMD_shader_atomic_counter_ops 1 +#endif /* GL_AMD_shader_atomic_counter_ops */ + #ifndef GL_AMD_shader_stencil_export #define GL_AMD_shader_stencil_export 1 #endif /* GL_AMD_shader_stencil_export */ @@ -4979,13 +4995,13 @@ GLAPI void APIENTRY glTessellationModeAMD (GLenum mode); #define GL_ELEMENT_ARRAY_APPLE 0x8A0C #define GL_ELEMENT_ARRAY_TYPE_APPLE 0x8A0D #define GL_ELEMENT_ARRAY_POINTER_APPLE 0x8A0E -typedef void (APIENTRYP PFNGLELEMENTPOINTERAPPLEPROC) (GLenum type, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLELEMENTPOINTERAPPLEPROC) (GLenum type, const void *pointer); typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, GLint first, GLsizei count); typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count); typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); typedef void (APIENTRYP PFNGLMULTIDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, const GLint *first, const GLsizei *count, GLsizei primcount); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glElementPointerAPPLE (GLenum type, const GLvoid *pointer); +GLAPI void APIENTRY glElementPointerAPPLE (GLenum type, const void *pointer); GLAPI void APIENTRY glDrawElementArrayAPPLE (GLenum mode, GLint first, GLsizei count); GLAPI void APIENTRY glDrawRangeElementArrayAPPLE (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count); GLAPI void APIENTRY glMultiDrawElementArrayAPPLE (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); @@ -5070,6 +5086,7 @@ GLAPI void APIENTRY glGetObjectParameterivAPPLE (GLenum objectType, GLuint name, #define GL_RGB_422_APPLE 0x8A1F #define GL_UNSIGNED_SHORT_8_8_APPLE 0x85BA #define GL_UNSIGNED_SHORT_8_8_REV_APPLE 0x85BB +#define GL_RGB_RAW_422_APPLE 0x8A51 #endif /* GL_APPLE_rgb_422 */ #ifndef GL_APPLE_row_bytes @@ -5091,11 +5108,11 @@ GLAPI void APIENTRY glGetObjectParameterivAPPLE (GLenum objectType, GLuint name, #define GL_STORAGE_PRIVATE_APPLE 0x85BD #define GL_STORAGE_CACHED_APPLE 0x85BE #define GL_STORAGE_SHARED_APPLE 0x85BF -typedef void (APIENTRYP PFNGLTEXTURERANGEAPPLEPROC) (GLenum target, GLsizei length, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLGETTEXPARAMETERPOINTERVAPPLEPROC) (GLenum target, GLenum pname, GLvoid **params); +typedef void (APIENTRYP PFNGLTEXTURERANGEAPPLEPROC) (GLenum target, GLsizei length, const void *pointer); +typedef void (APIENTRYP PFNGLGETTEXPARAMETERPOINTERVAPPLEPROC) (GLenum target, GLenum pname, void **params); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTextureRangeAPPLE (GLenum target, GLsizei length, const GLvoid *pointer); -GLAPI void APIENTRY glGetTexParameterPointervAPPLE (GLenum target, GLenum pname, GLvoid **params); +GLAPI void APIENTRY glTextureRangeAPPLE (GLenum target, GLsizei length, const void *pointer); +GLAPI void APIENTRY glGetTexParameterPointervAPPLE (GLenum target, GLenum pname, void **params); #endif #endif /* GL_APPLE_texture_range */ @@ -5126,12 +5143,12 @@ GLAPI GLboolean APIENTRY glIsVertexArrayAPPLE (GLuint array); #define GL_VERTEX_ARRAY_STORAGE_HINT_APPLE 0x851F #define GL_VERTEX_ARRAY_RANGE_POINTER_APPLE 0x8521 #define GL_STORAGE_CLIENT_APPLE 0x85B4 -typedef void (APIENTRYP PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer); -typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, void *pointer); +typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, void *pointer); typedef void (APIENTRYP PFNGLVERTEXARRAYPARAMETERIAPPLEPROC) (GLenum pname, GLint param); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertexArrayRangeAPPLE (GLsizei length, GLvoid *pointer); -GLAPI void APIENTRY glFlushVertexArrayRangeAPPLE (GLsizei length, GLvoid *pointer); +GLAPI void APIENTRY glVertexArrayRangeAPPLE (GLsizei length, void *pointer); +GLAPI void APIENTRY glFlushVertexArrayRangeAPPLE (GLsizei length, void *pointer); GLAPI void APIENTRY glVertexArrayParameteriAPPLE (GLenum pname, GLint param); #endif #endif /* GL_APPLE_vertex_array_range */ @@ -5201,11 +5218,11 @@ GLAPI void APIENTRY glDrawBuffersATI (GLsizei n, const GLenum *bufs); #define GL_ELEMENT_ARRAY_ATI 0x8768 #define GL_ELEMENT_ARRAY_TYPE_ATI 0x8769 #define GL_ELEMENT_ARRAY_POINTER_ATI 0x876A -typedef void (APIENTRYP PFNGLELEMENTPOINTERATIPROC) (GLenum type, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLELEMENTPOINTERATIPROC) (GLenum type, const void *pointer); typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYATIPROC) (GLenum mode, GLsizei count); typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYATIPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glElementPointerATI (GLenum type, const GLvoid *pointer); +GLAPI void APIENTRY glElementPointerATI (GLenum type, const void *pointer); GLAPI void APIENTRY glDrawElementArrayATI (GLenum mode, GLsizei count); GLAPI void APIENTRY glDrawRangeElementArrayATI (GLenum mode, GLuint start, GLuint end, GLsizei count); #endif @@ -5471,9 +5488,9 @@ GLAPI void APIENTRY glStencilFuncSeparateATI (GLenum frontfunc, GLenum backfunc, #define GL_OBJECT_BUFFER_USAGE_ATI 0x8765 #define GL_ARRAY_OBJECT_BUFFER_ATI 0x8766 #define GL_ARRAY_OBJECT_OFFSET_ATI 0x8767 -typedef GLuint (APIENTRYP PFNGLNEWOBJECTBUFFERATIPROC) (GLsizei size, const GLvoid *pointer, GLenum usage); +typedef GLuint (APIENTRYP PFNGLNEWOBJECTBUFFERATIPROC) (GLsizei size, const void *pointer, GLenum usage); typedef GLboolean (APIENTRYP PFNGLISOBJECTBUFFERATIPROC) (GLuint buffer); -typedef void (APIENTRYP PFNGLUPDATEOBJECTBUFFERATIPROC) (GLuint buffer, GLuint offset, GLsizei size, const GLvoid *pointer, GLenum preserve); +typedef void (APIENTRYP PFNGLUPDATEOBJECTBUFFERATIPROC) (GLuint buffer, GLuint offset, GLsizei size, const void *pointer, GLenum preserve); typedef void (APIENTRYP PFNGLGETOBJECTBUFFERFVATIPROC) (GLuint buffer, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETOBJECTBUFFERIVATIPROC) (GLuint buffer, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLFREEOBJECTBUFFERATIPROC) (GLuint buffer); @@ -5484,9 +5501,9 @@ typedef void (APIENTRYP PFNGLVARIANTARRAYOBJECTATIPROC) (GLuint id, GLenum type, typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTFVATIPROC) (GLuint id, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTIVATIPROC) (GLuint id, GLenum pname, GLint *params); #ifdef GL_GLEXT_PROTOTYPES -GLAPI GLuint APIENTRY glNewObjectBufferATI (GLsizei size, const GLvoid *pointer, GLenum usage); +GLAPI GLuint APIENTRY glNewObjectBufferATI (GLsizei size, const void *pointer, GLenum usage); GLAPI GLboolean APIENTRY glIsObjectBufferATI (GLuint buffer); -GLAPI void APIENTRY glUpdateObjectBufferATI (GLuint buffer, GLuint offset, GLsizei size, const GLvoid *pointer, GLenum preserve); +GLAPI void APIENTRY glUpdateObjectBufferATI (GLuint buffer, GLuint offset, GLsizei size, const void *pointer, GLenum preserve); GLAPI void APIENTRY glGetObjectBufferfvATI (GLuint buffer, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetObjectBufferivATI (GLuint buffer, GLenum pname, GLint *params); GLAPI void APIENTRY glFreeObjectBufferATI (GLuint buffer); @@ -5726,10 +5743,10 @@ GLAPI void APIENTRY glBlendEquationEXT (GLenum mode); #ifndef GL_EXT_color_subtable #define GL_EXT_color_subtable 1 -typedef void (APIENTRYP PFNGLCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const void *data); typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorSubTableEXT (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); +GLAPI void APIENTRY glColorSubTableEXT (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const void *data); GLAPI void APIENTRY glCopyColorSubTableEXT (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); #endif #endif /* GL_EXT_color_subtable */ @@ -5768,33 +5785,33 @@ GLAPI void APIENTRY glUnlockArraysEXT (void); #define GL_POST_CONVOLUTION_GREEN_BIAS_EXT 0x8021 #define GL_POST_CONVOLUTION_BLUE_BIAS_EXT 0x8022 #define GL_POST_CONVOLUTION_ALPHA_BIAS_EXT 0x8023 -typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); -typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *image); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat params); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint params); typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); -typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, void *image); typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETSEPARABLEFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); -typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); +typedef void (APIENTRYP PFNGLGETSEPARABLEFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, void *row, void *column, void *span); +typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *row, const void *column); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glConvolutionFilter1DEXT (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); -GLAPI void APIENTRY glConvolutionFilter2DEXT (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); +GLAPI void APIENTRY glConvolutionFilter1DEXT (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *image); +GLAPI void APIENTRY glConvolutionFilter2DEXT (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *image); GLAPI void APIENTRY glConvolutionParameterfEXT (GLenum target, GLenum pname, GLfloat params); GLAPI void APIENTRY glConvolutionParameterfvEXT (GLenum target, GLenum pname, const GLfloat *params); GLAPI void APIENTRY glConvolutionParameteriEXT (GLenum target, GLenum pname, GLint params); GLAPI void APIENTRY glConvolutionParameterivEXT (GLenum target, GLenum pname, const GLint *params); GLAPI void APIENTRY glCopyConvolutionFilter1DEXT (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); GLAPI void APIENTRY glCopyConvolutionFilter2DEXT (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); -GLAPI void APIENTRY glGetConvolutionFilterEXT (GLenum target, GLenum format, GLenum type, GLvoid *image); +GLAPI void APIENTRY glGetConvolutionFilterEXT (GLenum target, GLenum format, GLenum type, void *image); GLAPI void APIENTRY glGetConvolutionParameterfvEXT (GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetConvolutionParameterivEXT (GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetSeparableFilterEXT (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); -GLAPI void APIENTRY glSeparableFilter2DEXT (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); +GLAPI void APIENTRY glGetSeparableFilterEXT (GLenum target, GLenum format, GLenum type, void *row, void *column, void *span); +GLAPI void APIENTRY glSeparableFilter2DEXT (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *row, const void *column); #endif #endif /* GL_EXT_convolution */ @@ -5834,8 +5851,8 @@ typedef void (APIENTRYP PFNGLBINORMAL3IEXTPROC) (GLint bx, GLint by, GLint bz); typedef void (APIENTRYP PFNGLBINORMAL3IVEXTPROC) (const GLint *v); typedef void (APIENTRYP PFNGLBINORMAL3SEXTPROC) (GLshort bx, GLshort by, GLshort bz); typedef void (APIENTRYP PFNGLBINORMAL3SVEXTPROC) (const GLshort *v); -typedef void (APIENTRYP PFNGLTANGENTPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLBINORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLTANGENTPOINTEREXTPROC) (GLenum type, GLsizei stride, const void *pointer); +typedef void (APIENTRYP PFNGLBINORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, const void *pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glTangent3bEXT (GLbyte tx, GLbyte ty, GLbyte tz); GLAPI void APIENTRY glTangent3bvEXT (const GLbyte *v); @@ -5857,8 +5874,8 @@ GLAPI void APIENTRY glBinormal3iEXT (GLint bx, GLint by, GLint bz); GLAPI void APIENTRY glBinormal3ivEXT (const GLint *v); GLAPI void APIENTRY glBinormal3sEXT (GLshort bx, GLshort by, GLshort bz); GLAPI void APIENTRY glBinormal3svEXT (const GLshort *v); -GLAPI void APIENTRY glTangentPointerEXT (GLenum type, GLsizei stride, const GLvoid *pointer); -GLAPI void APIENTRY glBinormalPointerEXT (GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glTangentPointerEXT (GLenum type, GLsizei stride, const void *pointer); +GLAPI void APIENTRY glBinormalPointerEXT (GLenum type, GLsizei stride, const void *pointer); #endif #endif /* GL_EXT_coordinate_frame */ @@ -5927,24 +5944,24 @@ typedef void (APIENTRYP PFNGLTEXTUREPARAMETERFEXTPROC) (GLuint texture, GLenum t typedef void (APIENTRYP PFNGLTEXTUREPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLint param); typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLint *params); -typedef void (APIENTRYP PFNGLTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); typedef void (APIENTRYP PFNGLCOPYTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); typedef void (APIENTRYP PFNGLCOPYTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); -typedef void (APIENTRYP PFNGLGETTEXTUREIMAGEEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum format, GLenum type, GLvoid *pixels); +typedef void (APIENTRYP PFNGLGETTEXTUREIMAGEEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum format, GLenum type, void *pixels); typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETTEXTURELEVELPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETTEXTURELEVELPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLTEXTUREIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); typedef void (APIENTRYP PFNGLBINDMULTITEXTUREEXTPROC) (GLenum texunit, GLenum target, GLuint texture); -typedef void (APIENTRYP PFNGLMULTITEXCOORDPOINTEREXTPROC) (GLenum texunit, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLMULTITEXCOORDPOINTEREXTPROC) (GLenum texunit, GLint size, GLenum type, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLMULTITEXENVFEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLMULTITEXENVFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLMULTITEXENVIEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint param); @@ -5964,57 +5981,57 @@ typedef void (APIENTRYP PFNGLMULTITEXPARAMETERIEXTPROC) (GLenum texunit, GLenum typedef void (APIENTRYP PFNGLMULTITEXPARAMETERIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLMULTITEXPARAMETERFEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat param); typedef void (APIENTRYP PFNGLMULTITEXPARAMETERFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); typedef void (APIENTRYP PFNGLCOPYMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); typedef void (APIENTRYP PFNGLCOPYMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); typedef void (APIENTRYP PFNGLCOPYMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); typedef void (APIENTRYP PFNGLCOPYMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); -typedef void (APIENTRYP PFNGLGETMULTITEXIMAGEEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum format, GLenum type, GLvoid *pixels); +typedef void (APIENTRYP PFNGLGETMULTITEXIMAGEEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum format, GLenum type, void *pixels); typedef void (APIENTRYP PFNGLGETMULTITEXPARAMETERFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETMULTITEXPARAMETERIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETMULTITEXLEVELPARAMETERFVEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETMULTITEXLEVELPARAMETERIVEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLMULTITEXIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLMULTITEXIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); typedef void (APIENTRYP PFNGLCOPYMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); typedef void (APIENTRYP PFNGLENABLECLIENTSTATEINDEXEDEXTPROC) (GLenum array, GLuint index); typedef void (APIENTRYP PFNGLDISABLECLIENTSTATEINDEXEDEXTPROC) (GLenum array, GLuint index); typedef void (APIENTRYP PFNGLGETFLOATINDEXEDVEXTPROC) (GLenum target, GLuint index, GLfloat *data); typedef void (APIENTRYP PFNGLGETDOUBLEINDEXEDVEXTPROC) (GLenum target, GLuint index, GLdouble *data); -typedef void (APIENTRYP PFNGLGETPOINTERINDEXEDVEXTPROC) (GLenum target, GLuint index, GLvoid **data); +typedef void (APIENTRYP PFNGLGETPOINTERINDEXEDVEXTPROC) (GLenum target, GLuint index, void **data); typedef void (APIENTRYP PFNGLENABLEINDEXEDEXTPROC) (GLenum target, GLuint index); typedef void (APIENTRYP PFNGLDISABLEINDEXEDEXTPROC) (GLenum target, GLuint index); typedef GLboolean (APIENTRYP PFNGLISENABLEDINDEXEDEXTPROC) (GLenum target, GLuint index); typedef void (APIENTRYP PFNGLGETINTEGERINDEXEDVEXTPROC) (GLenum target, GLuint index, GLint *data); typedef void (APIENTRYP PFNGLGETBOOLEANINDEXEDVEXTPROC) (GLenum target, GLuint index, GLboolean *data); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXTUREIMAGEEXTPROC) (GLuint texture, GLenum target, GLint lod, GLvoid *img); -typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *bits); -typedef void (APIENTRYP PFNGLGETCOMPRESSEDMULTITEXIMAGEEXTPROC) (GLenum texunit, GLenum target, GLint lod, GLvoid *img); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXTUREIMAGEEXTPROC) (GLuint texture, GLenum target, GLint lod, void *img); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDMULTITEXIMAGEEXTPROC) (GLenum texunit, GLenum target, GLint lod, void *img); typedef void (APIENTRYP PFNGLMATRIXLOADTRANSPOSEFEXTPROC) (GLenum mode, const GLfloat *m); typedef void (APIENTRYP PFNGLMATRIXLOADTRANSPOSEDEXTPROC) (GLenum mode, const GLdouble *m); typedef void (APIENTRYP PFNGLMATRIXMULTTRANSPOSEFEXTPROC) (GLenum mode, const GLfloat *m); typedef void (APIENTRYP PFNGLMATRIXMULTTRANSPOSEDEXTPROC) (GLenum mode, const GLdouble *m); -typedef void (APIENTRYP PFNGLNAMEDBUFFERDATAEXTPROC) (GLuint buffer, GLsizeiptr size, const GLvoid *data, GLenum usage); -typedef void (APIENTRYP PFNGLNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, const GLvoid *data); +typedef void (APIENTRYP PFNGLNAMEDBUFFERDATAEXTPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFEREXTPROC) (GLuint buffer, GLenum access); typedef GLboolean (APIENTRYP PFNGLUNMAPNAMEDBUFFEREXTPROC) (GLuint buffer); typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERIVEXTPROC) (GLuint buffer, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPOINTERVEXTPROC) (GLuint buffer, GLenum pname, GLvoid **params); -typedef void (APIENTRYP PFNGLGETNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLvoid *data); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPOINTERVEXTPROC) (GLuint buffer, GLenum pname, void **params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data); typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1FEXTPROC) (GLuint program, GLint location, GLfloat v0); typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1); typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2); @@ -6071,8 +6088,8 @@ typedef void (APIENTRYP PFNGLENABLECLIENTSTATEIEXTPROC) (GLenum array, GLuint in typedef void (APIENTRYP PFNGLDISABLECLIENTSTATEIEXTPROC) (GLenum array, GLuint index); typedef void (APIENTRYP PFNGLGETFLOATI_VEXTPROC) (GLenum pname, GLuint index, GLfloat *params); typedef void (APIENTRYP PFNGLGETDOUBLEI_VEXTPROC) (GLenum pname, GLuint index, GLdouble *params); -typedef void (APIENTRYP PFNGLGETPOINTERI_VEXTPROC) (GLenum pname, GLuint index, GLvoid **params); -typedef void (APIENTRYP PFNGLNAMEDPROGRAMSTRINGEXTPROC) (GLuint program, GLenum target, GLenum format, GLsizei len, const GLvoid *string); +typedef void (APIENTRYP PFNGLGETPOINTERI_VEXTPROC) (GLenum pname, GLuint index, void **params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMSTRINGEXTPROC) (GLuint program, GLenum target, GLenum format, GLsizei len, const void *string); typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4DEXTPROC) (GLuint program, GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4DVEXTPROC) (GLuint program, GLenum target, GLuint index, const GLdouble *params); typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4FEXTPROC) (GLuint program, GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); @@ -6080,7 +6097,7 @@ typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4FVEXTPROC) (GLuint progr typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMLOCALPARAMETERDVEXTPROC) (GLuint program, GLenum target, GLuint index, GLdouble *params); typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMLOCALPARAMETERFVEXTPROC) (GLuint program, GLenum target, GLuint index, GLfloat *params); typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMIVEXTPROC) (GLuint program, GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMSTRINGEXTPROC) (GLuint program, GLenum target, GLenum pname, GLvoid *string); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMSTRINGEXTPROC) (GLuint program, GLenum target, GLenum pname, void *string); typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEEXTPROC) (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height); typedef void (APIENTRYP PFNGLGETNAMEDRENDERBUFFERPARAMETERIVEXTPROC) (GLuint renderbuffer, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEEXTPROC) (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); @@ -6119,11 +6136,12 @@ typedef void (APIENTRYP PFNGLDISABLEVERTEXARRAYEXTPROC) (GLuint vaobj, GLenum ar typedef void (APIENTRYP PFNGLENABLEVERTEXARRAYATTRIBEXTPROC) (GLuint vaobj, GLuint index); typedef void (APIENTRYP PFNGLDISABLEVERTEXARRAYATTRIBEXTPROC) (GLuint vaobj, GLuint index); typedef void (APIENTRYP PFNGLGETVERTEXARRAYINTEGERVEXTPROC) (GLuint vaobj, GLenum pname, GLint *param); -typedef void (APIENTRYP PFNGLGETVERTEXARRAYPOINTERVEXTPROC) (GLuint vaobj, GLenum pname, GLvoid **param); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYPOINTERVEXTPROC) (GLuint vaobj, GLenum pname, void **param); typedef void (APIENTRYP PFNGLGETVERTEXARRAYINTEGERI_VEXTPROC) (GLuint vaobj, GLuint index, GLenum pname, GLint *param); -typedef void (APIENTRYP PFNGLGETVERTEXARRAYPOINTERI_VEXTPROC) (GLuint vaobj, GLuint index, GLenum pname, GLvoid **param); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYPOINTERI_VEXTPROC) (GLuint vaobj, GLuint index, GLenum pname, void **param); typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFERRANGEEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); typedef void (APIENTRYP PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSTORAGEEXTPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags); typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERDATAEXTPROC) (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data); typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, GLsizeiptr offset, GLsizeiptr size, const void *data); typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERPARAMETERIEXTPROC) (GLuint framebuffer, GLenum pname, GLint param); @@ -6158,7 +6176,8 @@ typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBLFORMATEXTPROC) (GLuint vaob typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBBINDINGEXTPROC) (GLuint vaobj, GLuint attribindex, GLuint bindingindex); typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXBINDINGDIVISOREXTPROC) (GLuint vaobj, GLuint bindingindex, GLuint divisor); typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBLOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset); -typedef void (APIENTRYP PFNGLTEXTUREPAGECOMMITMENTEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident); +typedef void (APIENTRYP PFNGLTEXTUREPAGECOMMITMENTEXTPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBDIVISOREXTPROC) (GLuint vaobj, GLuint index, GLuint divisor); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glMatrixLoadfEXT (GLenum mode, const GLfloat *m); GLAPI void APIENTRY glMatrixLoaddEXT (GLenum mode, const GLdouble *m); @@ -6181,24 +6200,24 @@ GLAPI void APIENTRY glTextureParameterfEXT (GLuint texture, GLenum target, GLenu GLAPI void APIENTRY glTextureParameterfvEXT (GLuint texture, GLenum target, GLenum pname, const GLfloat *params); GLAPI void APIENTRY glTextureParameteriEXT (GLuint texture, GLenum target, GLenum pname, GLint param); GLAPI void APIENTRY glTextureParameterivEXT (GLuint texture, GLenum target, GLenum pname, const GLint *params); -GLAPI void APIENTRY glTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); GLAPI void APIENTRY glCopyTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); GLAPI void APIENTRY glCopyTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); GLAPI void APIENTRY glCopyTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); GLAPI void APIENTRY glCopyTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); -GLAPI void APIENTRY glGetTextureImageEXT (GLuint texture, GLenum target, GLint level, GLenum format, GLenum type, GLvoid *pixels); +GLAPI void APIENTRY glGetTextureImageEXT (GLuint texture, GLenum target, GLint level, GLenum format, GLenum type, void *pixels); GLAPI void APIENTRY glGetTextureParameterfvEXT (GLuint texture, GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetTextureParameterivEXT (GLuint texture, GLenum target, GLenum pname, GLint *params); GLAPI void APIENTRY glGetTextureLevelParameterfvEXT (GLuint texture, GLenum target, GLint level, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetTextureLevelParameterivEXT (GLuint texture, GLenum target, GLint level, GLenum pname, GLint *params); -GLAPI void APIENTRY glTextureImage3DEXT (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glTextureImage3DEXT (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); GLAPI void APIENTRY glCopyTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); GLAPI void APIENTRY glBindMultiTextureEXT (GLenum texunit, GLenum target, GLuint texture); -GLAPI void APIENTRY glMultiTexCoordPointerEXT (GLenum texunit, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glMultiTexCoordPointerEXT (GLenum texunit, GLint size, GLenum type, GLsizei stride, const void *pointer); GLAPI void APIENTRY glMultiTexEnvfEXT (GLenum texunit, GLenum target, GLenum pname, GLfloat param); GLAPI void APIENTRY glMultiTexEnvfvEXT (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); GLAPI void APIENTRY glMultiTexEnviEXT (GLenum texunit, GLenum target, GLenum pname, GLint param); @@ -6218,57 +6237,57 @@ GLAPI void APIENTRY glMultiTexParameteriEXT (GLenum texunit, GLenum target, GLen GLAPI void APIENTRY glMultiTexParameterivEXT (GLenum texunit, GLenum target, GLenum pname, const GLint *params); GLAPI void APIENTRY glMultiTexParameterfEXT (GLenum texunit, GLenum target, GLenum pname, GLfloat param); GLAPI void APIENTRY glMultiTexParameterfvEXT (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); -GLAPI void APIENTRY glMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); GLAPI void APIENTRY glCopyMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); GLAPI void APIENTRY glCopyMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); GLAPI void APIENTRY glCopyMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); GLAPI void APIENTRY glCopyMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); -GLAPI void APIENTRY glGetMultiTexImageEXT (GLenum texunit, GLenum target, GLint level, GLenum format, GLenum type, GLvoid *pixels); +GLAPI void APIENTRY glGetMultiTexImageEXT (GLenum texunit, GLenum target, GLint level, GLenum format, GLenum type, void *pixels); GLAPI void APIENTRY glGetMultiTexParameterfvEXT (GLenum texunit, GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetMultiTexParameterivEXT (GLenum texunit, GLenum target, GLenum pname, GLint *params); GLAPI void APIENTRY glGetMultiTexLevelParameterfvEXT (GLenum texunit, GLenum target, GLint level, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetMultiTexLevelParameterivEXT (GLenum texunit, GLenum target, GLint level, GLenum pname, GLint *params); -GLAPI void APIENTRY glMultiTexImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glMultiTexImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); GLAPI void APIENTRY glCopyMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); GLAPI void APIENTRY glEnableClientStateIndexedEXT (GLenum array, GLuint index); GLAPI void APIENTRY glDisableClientStateIndexedEXT (GLenum array, GLuint index); GLAPI void APIENTRY glGetFloatIndexedvEXT (GLenum target, GLuint index, GLfloat *data); GLAPI void APIENTRY glGetDoubleIndexedvEXT (GLenum target, GLuint index, GLdouble *data); -GLAPI void APIENTRY glGetPointerIndexedvEXT (GLenum target, GLuint index, GLvoid **data); +GLAPI void APIENTRY glGetPointerIndexedvEXT (GLenum target, GLuint index, void **data); GLAPI void APIENTRY glEnableIndexedEXT (GLenum target, GLuint index); GLAPI void APIENTRY glDisableIndexedEXT (GLenum target, GLuint index); GLAPI GLboolean APIENTRY glIsEnabledIndexedEXT (GLenum target, GLuint index); GLAPI void APIENTRY glGetIntegerIndexedvEXT (GLenum target, GLuint index, GLint *data); GLAPI void APIENTRY glGetBooleanIndexedvEXT (GLenum target, GLuint index, GLboolean *data); -GLAPI void APIENTRY glCompressedTextureImage3DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glGetCompressedTextureImageEXT (GLuint texture, GLenum target, GLint lod, GLvoid *img); -GLAPI void APIENTRY glCompressedMultiTexImage3DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glCompressedMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *bits); -GLAPI void APIENTRY glGetCompressedMultiTexImageEXT (GLenum texunit, GLenum target, GLint lod, GLvoid *img); +GLAPI void APIENTRY glCompressedTextureImage3DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glGetCompressedTextureImageEXT (GLuint texture, GLenum target, GLint lod, void *img); +GLAPI void APIENTRY glCompressedMultiTexImage3DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glGetCompressedMultiTexImageEXT (GLenum texunit, GLenum target, GLint lod, void *img); GLAPI void APIENTRY glMatrixLoadTransposefEXT (GLenum mode, const GLfloat *m); GLAPI void APIENTRY glMatrixLoadTransposedEXT (GLenum mode, const GLdouble *m); GLAPI void APIENTRY glMatrixMultTransposefEXT (GLenum mode, const GLfloat *m); GLAPI void APIENTRY glMatrixMultTransposedEXT (GLenum mode, const GLdouble *m); -GLAPI void APIENTRY glNamedBufferDataEXT (GLuint buffer, GLsizeiptr size, const GLvoid *data, GLenum usage); -GLAPI void APIENTRY glNamedBufferSubDataEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, const GLvoid *data); +GLAPI void APIENTRY glNamedBufferDataEXT (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage); +GLAPI void APIENTRY glNamedBufferSubDataEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); GLAPI void *APIENTRY glMapNamedBufferEXT (GLuint buffer, GLenum access); GLAPI GLboolean APIENTRY glUnmapNamedBufferEXT (GLuint buffer); GLAPI void APIENTRY glGetNamedBufferParameterivEXT (GLuint buffer, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetNamedBufferPointervEXT (GLuint buffer, GLenum pname, GLvoid **params); -GLAPI void APIENTRY glGetNamedBufferSubDataEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, GLvoid *data); +GLAPI void APIENTRY glGetNamedBufferPointervEXT (GLuint buffer, GLenum pname, void **params); +GLAPI void APIENTRY glGetNamedBufferSubDataEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data); GLAPI void APIENTRY glProgramUniform1fEXT (GLuint program, GLint location, GLfloat v0); GLAPI void APIENTRY glProgramUniform2fEXT (GLuint program, GLint location, GLfloat v0, GLfloat v1); GLAPI void APIENTRY glProgramUniform3fEXT (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2); @@ -6325,8 +6344,8 @@ GLAPI void APIENTRY glEnableClientStateiEXT (GLenum array, GLuint index); GLAPI void APIENTRY glDisableClientStateiEXT (GLenum array, GLuint index); GLAPI void APIENTRY glGetFloati_vEXT (GLenum pname, GLuint index, GLfloat *params); GLAPI void APIENTRY glGetDoublei_vEXT (GLenum pname, GLuint index, GLdouble *params); -GLAPI void APIENTRY glGetPointeri_vEXT (GLenum pname, GLuint index, GLvoid **params); -GLAPI void APIENTRY glNamedProgramStringEXT (GLuint program, GLenum target, GLenum format, GLsizei len, const GLvoid *string); +GLAPI void APIENTRY glGetPointeri_vEXT (GLenum pname, GLuint index, void **params); +GLAPI void APIENTRY glNamedProgramStringEXT (GLuint program, GLenum target, GLenum format, GLsizei len, const void *string); GLAPI void APIENTRY glNamedProgramLocalParameter4dEXT (GLuint program, GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); GLAPI void APIENTRY glNamedProgramLocalParameter4dvEXT (GLuint program, GLenum target, GLuint index, const GLdouble *params); GLAPI void APIENTRY glNamedProgramLocalParameter4fEXT (GLuint program, GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); @@ -6334,7 +6353,7 @@ GLAPI void APIENTRY glNamedProgramLocalParameter4fvEXT (GLuint program, GLenum t GLAPI void APIENTRY glGetNamedProgramLocalParameterdvEXT (GLuint program, GLenum target, GLuint index, GLdouble *params); GLAPI void APIENTRY glGetNamedProgramLocalParameterfvEXT (GLuint program, GLenum target, GLuint index, GLfloat *params); GLAPI void APIENTRY glGetNamedProgramivEXT (GLuint program, GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetNamedProgramStringEXT (GLuint program, GLenum target, GLenum pname, GLvoid *string); +GLAPI void APIENTRY glGetNamedProgramStringEXT (GLuint program, GLenum target, GLenum pname, void *string); GLAPI void APIENTRY glNamedRenderbufferStorageEXT (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height); GLAPI void APIENTRY glGetNamedRenderbufferParameterivEXT (GLuint renderbuffer, GLenum pname, GLint *params); GLAPI void APIENTRY glNamedRenderbufferStorageMultisampleEXT (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); @@ -6373,11 +6392,12 @@ GLAPI void APIENTRY glDisableVertexArrayEXT (GLuint vaobj, GLenum array); GLAPI void APIENTRY glEnableVertexArrayAttribEXT (GLuint vaobj, GLuint index); GLAPI void APIENTRY glDisableVertexArrayAttribEXT (GLuint vaobj, GLuint index); GLAPI void APIENTRY glGetVertexArrayIntegervEXT (GLuint vaobj, GLenum pname, GLint *param); -GLAPI void APIENTRY glGetVertexArrayPointervEXT (GLuint vaobj, GLenum pname, GLvoid **param); +GLAPI void APIENTRY glGetVertexArrayPointervEXT (GLuint vaobj, GLenum pname, void **param); GLAPI void APIENTRY glGetVertexArrayIntegeri_vEXT (GLuint vaobj, GLuint index, GLenum pname, GLint *param); -GLAPI void APIENTRY glGetVertexArrayPointeri_vEXT (GLuint vaobj, GLuint index, GLenum pname, GLvoid **param); +GLAPI void APIENTRY glGetVertexArrayPointeri_vEXT (GLuint vaobj, GLuint index, GLenum pname, void **param); GLAPI void *APIENTRY glMapNamedBufferRangeEXT (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); GLAPI void APIENTRY glFlushMappedNamedBufferRangeEXT (GLuint buffer, GLintptr offset, GLsizeiptr length); +GLAPI void APIENTRY glNamedBufferStorageEXT (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags); GLAPI void APIENTRY glClearNamedBufferDataEXT (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data); GLAPI void APIENTRY glClearNamedBufferSubDataEXT (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, GLsizeiptr offset, GLsizeiptr size, const void *data); GLAPI void APIENTRY glNamedFramebufferParameteriEXT (GLuint framebuffer, GLenum pname, GLint param); @@ -6412,7 +6432,8 @@ GLAPI void APIENTRY glVertexArrayVertexAttribLFormatEXT (GLuint vaobj, GLuint at GLAPI void APIENTRY glVertexArrayVertexAttribBindingEXT (GLuint vaobj, GLuint attribindex, GLuint bindingindex); GLAPI void APIENTRY glVertexArrayVertexBindingDivisorEXT (GLuint vaobj, GLuint bindingindex, GLuint divisor); GLAPI void APIENTRY glVertexArrayVertexAttribLOffsetEXT (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset); -GLAPI void APIENTRY glTexturePageCommitmentEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident); +GLAPI void APIENTRY glTexturePageCommitmentEXT (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean resident); +GLAPI void APIENTRY glVertexArrayVertexAttribDivisorEXT (GLuint vaobj, GLuint index, GLuint divisor); #endif #endif /* GL_EXT_direct_state_access */ @@ -6427,10 +6448,10 @@ GLAPI void APIENTRY glColorMaskIndexedEXT (GLuint index, GLboolean r, GLboolean #ifndef GL_EXT_draw_instanced #define GL_EXT_draw_instanced 1 typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDEXTPROC) (GLenum mode, GLint start, GLsizei count, GLsizei primcount); -typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDEXTPROC) (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glDrawArraysInstancedEXT (GLenum mode, GLint start, GLsizei count, GLsizei primcount); -GLAPI void APIENTRY glDrawElementsInstancedEXT (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount); +GLAPI void APIENTRY glDrawElementsInstancedEXT (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); #endif #endif /* GL_EXT_draw_instanced */ @@ -6438,9 +6459,9 @@ GLAPI void APIENTRY glDrawElementsInstancedEXT (GLenum mode, GLsizei count, GLen #define GL_EXT_draw_range_elements 1 #define GL_MAX_ELEMENTS_VERTICES_EXT 0x80E8 #define GL_MAX_ELEMENTS_INDICES_EXT 0x80E9 -typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glDrawRangeElementsEXT (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); +GLAPI void APIENTRY glDrawRangeElementsEXT (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices); #endif #endif /* GL_EXT_draw_range_elements */ @@ -6458,13 +6479,13 @@ typedef void (APIENTRYP PFNGLFOGCOORDFEXTPROC) (GLfloat coord); typedef void (APIENTRYP PFNGLFOGCOORDFVEXTPROC) (const GLfloat *coord); typedef void (APIENTRYP PFNGLFOGCOORDDEXTPROC) (GLdouble coord); typedef void (APIENTRYP PFNGLFOGCOORDDVEXTPROC) (const GLdouble *coord); -typedef void (APIENTRYP PFNGLFOGCOORDPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLFOGCOORDPOINTEREXTPROC) (GLenum type, GLsizei stride, const void *pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glFogCoordfEXT (GLfloat coord); GLAPI void APIENTRY glFogCoordfvEXT (const GLfloat *coord); GLAPI void APIENTRY glFogCoorddEXT (GLdouble coord); GLAPI void APIENTRY glFogCoorddvEXT (const GLdouble *coord); -GLAPI void APIENTRY glFogCoordPointerEXT (GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glFogCoordPointerEXT (GLenum type, GLsizei stride, const void *pointer); #endif #endif /* GL_EXT_fog_coord */ @@ -6704,10 +6725,10 @@ GLAPI void APIENTRY glUniform4uivEXT (GLint location, GLsizei count, const GLuin #define GL_MINMAX_FORMAT_EXT 0x802F #define GL_MINMAX_SINK_EXT 0x8030 #define GL_TABLE_TOO_LARGE_EXT 0x8031 -typedef void (APIENTRYP PFNGLGETHISTOGRAMEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +typedef void (APIENTRYP PFNGLGETHISTOGRAMEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETMINMAXEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +typedef void (APIENTRYP PFNGLGETMINMAXEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLHISTOGRAMEXTPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); @@ -6715,10 +6736,10 @@ typedef void (APIENTRYP PFNGLMINMAXEXTPROC) (GLenum target, GLenum internalforma typedef void (APIENTRYP PFNGLRESETHISTOGRAMEXTPROC) (GLenum target); typedef void (APIENTRYP PFNGLRESETMINMAXEXTPROC) (GLenum target); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glGetHistogramEXT (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +GLAPI void APIENTRY glGetHistogramEXT (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); GLAPI void APIENTRY glGetHistogramParameterfvEXT (GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetHistogramParameterivEXT (GLenum target, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetMinmaxEXT (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +GLAPI void APIENTRY glGetMinmaxEXT (GLenum target, GLboolean reset, GLenum format, GLenum type, void *values); GLAPI void APIENTRY glGetMinmaxParameterfvEXT (GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetMinmaxParameterivEXT (GLenum target, GLenum pname, GLint *params); GLAPI void APIENTRY glHistogramEXT (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); @@ -6794,10 +6815,10 @@ GLAPI void APIENTRY glTextureMaterialEXT (GLenum face, GLenum mode); #ifndef GL_EXT_multi_draw_arrays #define GL_EXT_multi_draw_arrays 1 typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSEXTPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid *const*indices, GLsizei primcount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glMultiDrawArraysEXT (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); -GLAPI void APIENTRY glMultiDrawElementsEXT (GLenum mode, const GLsizei *count, GLenum type, const GLvoid *const*indices, GLsizei primcount); +GLAPI void APIENTRY glMultiDrawElementsEXT (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount); #endif #endif /* GL_EXT_multi_draw_arrays */ @@ -6861,13 +6882,13 @@ GLAPI void APIENTRY glSamplePatternEXT (GLenum pattern); #define GL_COLOR_INDEX12_EXT 0x80E6 #define GL_COLOR_INDEX16_EXT 0x80E7 #define GL_TEXTURE_INDEX_SIZE_EXT 0x80ED -typedef void (APIENTRYP PFNGLCOLORTABLEEXTPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); -typedef void (APIENTRYP PFNGLGETCOLORTABLEEXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *data); +typedef void (APIENTRYP PFNGLCOLORTABLEEXTPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const void *table); +typedef void (APIENTRYP PFNGLGETCOLORTABLEEXTPROC) (GLenum target, GLenum format, GLenum type, void *data); typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorTableEXT (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); -GLAPI void APIENTRY glGetColorTableEXT (GLenum target, GLenum format, GLenum type, GLvoid *data); +GLAPI void APIENTRY glColorTableEXT (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const void *table); +GLAPI void APIENTRY glGetColorTableEXT (GLenum target, GLenum format, GLenum type, void *data); GLAPI void APIENTRY glGetColorTableParameterivEXT (GLenum target, GLenum pname, GLint *params); GLAPI void APIENTRY glGetColorTableParameterfvEXT (GLenum target, GLenum pname, GLfloat *params); #endif @@ -6979,7 +7000,7 @@ typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIEXTPROC) (GLuint red, GLuint green typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVEXTPROC) (const GLuint *v); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USEXTPROC) (GLushort red, GLushort green, GLushort blue); typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVEXTPROC) (const GLushort *v); -typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const void *pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glSecondaryColor3bEXT (GLbyte red, GLbyte green, GLbyte blue); GLAPI void APIENTRY glSecondaryColor3bvEXT (const GLbyte *v); @@ -6997,7 +7018,7 @@ GLAPI void APIENTRY glSecondaryColor3uiEXT (GLuint red, GLuint green, GLuint blu GLAPI void APIENTRY glSecondaryColor3uivEXT (const GLuint *v); GLAPI void APIENTRY glSecondaryColor3usEXT (GLushort red, GLushort green, GLushort blue); GLAPI void APIENTRY glSecondaryColor3usvEXT (const GLushort *v); -GLAPI void APIENTRY glSecondaryColorPointerEXT (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glSecondaryColorPointerEXT (GLint size, GLenum type, GLsizei stride, const void *pointer); #endif #endif /* GL_EXT_secondary_color */ @@ -7086,6 +7107,10 @@ GLAPI void APIENTRY glMemoryBarrierEXT (GLbitfield barriers); #endif #endif /* GL_EXT_shader_image_load_store */ +#ifndef GL_EXT_shader_integer_mix +#define GL_EXT_shader_integer_mix 1 +#endif /* GL_EXT_shader_integer_mix */ + #ifndef GL_EXT_shadow_funcs #define GL_EXT_shadow_funcs 1 #endif /* GL_EXT_shadow_funcs */ @@ -7123,11 +7148,11 @@ GLAPI void APIENTRY glActiveStencilFaceEXT (GLenum face); #ifndef GL_EXT_subtexture #define GL_EXT_subtexture 1 -typedef void (APIENTRYP PFNGLTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTexSubImage1DEXT (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glTexSubImage2DEXT (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glTexSubImage1DEXT (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTexSubImage2DEXT (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); #endif #endif /* GL_EXT_subtexture */ @@ -7189,11 +7214,11 @@ GLAPI void APIENTRY glTexSubImage2DEXT (GLenum target, GLint level, GLint xoffse #define GL_TEXTURE_DEPTH_EXT 0x8071 #define GL_TEXTURE_WRAP_R_EXT 0x8072 #define GL_MAX_3D_TEXTURE_SIZE_EXT 0x8073 -typedef void (APIENTRYP PFNGLTEXIMAGE3DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXIMAGE3DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTexImage3DEXT (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glTexSubImage3DEXT (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glTexImage3DEXT (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTexSubImage3DEXT (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); #endif #endif /* GL_EXT_texture3D */ @@ -7559,24 +7584,24 @@ GLAPI void APIENTRY glGetTransformFeedbackVaryingEXT (GLuint program, GLuint ind #define GL_TEXTURE_COORD_ARRAY_POINTER_EXT 0x8092 #define GL_EDGE_FLAG_ARRAY_POINTER_EXT 0x8093 typedef void (APIENTRYP PFNGLARRAYELEMENTEXTPROC) (GLint i); -typedef void (APIENTRYP PFNGLCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const void *pointer); typedef void (APIENTRYP PFNGLDRAWARRAYSEXTPROC) (GLenum mode, GLint first, GLsizei count); typedef void (APIENTRYP PFNGLEDGEFLAGPOINTEREXTPROC) (GLsizei stride, GLsizei count, const GLboolean *pointer); -typedef void (APIENTRYP PFNGLGETPOINTERVEXTPROC) (GLenum pname, GLvoid **params); -typedef void (APIENTRYP PFNGLINDEXPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLNORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLTEXCOORDPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -typedef void (APIENTRYP PFNGLVERTEXPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLGETPOINTERVEXTPROC) (GLenum pname, void **params); +typedef void (APIENTRYP PFNGLINDEXPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const void *pointer); +typedef void (APIENTRYP PFNGLNORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const void *pointer); +typedef void (APIENTRYP PFNGLTEXCOORDPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const void *pointer); +typedef void (APIENTRYP PFNGLVERTEXPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const void *pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glArrayElementEXT (GLint i); -GLAPI void APIENTRY glColorPointerEXT (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +GLAPI void APIENTRY glColorPointerEXT (GLint size, GLenum type, GLsizei stride, GLsizei count, const void *pointer); GLAPI void APIENTRY glDrawArraysEXT (GLenum mode, GLint first, GLsizei count); GLAPI void APIENTRY glEdgeFlagPointerEXT (GLsizei stride, GLsizei count, const GLboolean *pointer); -GLAPI void APIENTRY glGetPointervEXT (GLenum pname, GLvoid **params); -GLAPI void APIENTRY glIndexPointerEXT (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -GLAPI void APIENTRY glNormalPointerEXT (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -GLAPI void APIENTRY glTexCoordPointerEXT (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); -GLAPI void APIENTRY glVertexPointerEXT (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +GLAPI void APIENTRY glGetPointervEXT (GLenum pname, void **params); +GLAPI void APIENTRY glIndexPointerEXT (GLenum type, GLsizei stride, GLsizei count, const void *pointer); +GLAPI void APIENTRY glNormalPointerEXT (GLenum type, GLsizei stride, GLsizei count, const void *pointer); +GLAPI void APIENTRY glTexCoordPointerEXT (GLint size, GLenum type, GLsizei stride, GLsizei count, const void *pointer); +GLAPI void APIENTRY glVertexPointerEXT (GLint size, GLenum type, GLsizei stride, GLsizei count, const void *pointer); #endif #endif /* GL_EXT_vertex_array */ @@ -7606,7 +7631,7 @@ typedef void (APIENTRYP PFNGLVERTEXATTRIBL1DVEXTPROC) (GLuint index, const GLdou typedef void (APIENTRYP PFNGLVERTEXATTRIBL2DVEXTPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBL3DVEXTPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBL4DVEXTPROC) (GLuint index, const GLdouble *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBLPOINTEREXTPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXATTRIBLPOINTEREXTPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBLDVEXTPROC) (GLuint index, GLenum pname, GLdouble *params); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glVertexAttribL1dEXT (GLuint index, GLdouble x); @@ -7617,7 +7642,7 @@ GLAPI void APIENTRY glVertexAttribL1dvEXT (GLuint index, const GLdouble *v); GLAPI void APIENTRY glVertexAttribL2dvEXT (GLuint index, const GLdouble *v); GLAPI void APIENTRY glVertexAttribL3dvEXT (GLuint index, const GLdouble *v); GLAPI void APIENTRY glVertexAttribL4dvEXT (GLuint index, const GLdouble *v); -GLAPI void APIENTRY glVertexAttribLPointerEXT (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glVertexAttribLPointerEXT (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); GLAPI void APIENTRY glGetVertexAttribLdvEXT (GLuint index, GLenum pname, GLdouble *params); #endif #endif /* GL_EXT_vertex_attrib_64bit */ @@ -7747,8 +7772,8 @@ typedef void (APIENTRYP PFNGLWRITEMASKEXTPROC) (GLuint res, GLuint in, GLenum ou typedef void (APIENTRYP PFNGLINSERTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num); typedef void (APIENTRYP PFNGLEXTRACTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num); typedef GLuint (APIENTRYP PFNGLGENSYMBOLSEXTPROC) (GLenum datatype, GLenum storagetype, GLenum range, GLuint components); -typedef void (APIENTRYP PFNGLSETINVARIANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr); -typedef void (APIENTRYP PFNGLSETLOCALCONSTANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr); +typedef void (APIENTRYP PFNGLSETINVARIANTEXTPROC) (GLuint id, GLenum type, const void *addr); +typedef void (APIENTRYP PFNGLSETLOCALCONSTANTEXTPROC) (GLuint id, GLenum type, const void *addr); typedef void (APIENTRYP PFNGLVARIANTBVEXTPROC) (GLuint id, const GLbyte *addr); typedef void (APIENTRYP PFNGLVARIANTSVEXTPROC) (GLuint id, const GLshort *addr); typedef void (APIENTRYP PFNGLVARIANTIVEXTPROC) (GLuint id, const GLint *addr); @@ -7757,7 +7782,7 @@ typedef void (APIENTRYP PFNGLVARIANTDVEXTPROC) (GLuint id, const GLdouble *addr) typedef void (APIENTRYP PFNGLVARIANTUBVEXTPROC) (GLuint id, const GLubyte *addr); typedef void (APIENTRYP PFNGLVARIANTUSVEXTPROC) (GLuint id, const GLushort *addr); typedef void (APIENTRYP PFNGLVARIANTUIVEXTPROC) (GLuint id, const GLuint *addr); -typedef void (APIENTRYP PFNGLVARIANTPOINTEREXTPROC) (GLuint id, GLenum type, GLuint stride, const GLvoid *addr); +typedef void (APIENTRYP PFNGLVARIANTPOINTEREXTPROC) (GLuint id, GLenum type, GLuint stride, const void *addr); typedef void (APIENTRYP PFNGLENABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id); typedef void (APIENTRYP PFNGLDISABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id); typedef GLuint (APIENTRYP PFNGLBINDLIGHTPARAMETEREXTPROC) (GLenum light, GLenum value); @@ -7769,7 +7794,7 @@ typedef GLboolean (APIENTRYP PFNGLISVARIANTENABLEDEXTPROC) (GLuint id, GLenum ca typedef void (APIENTRYP PFNGLGETVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); typedef void (APIENTRYP PFNGLGETVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); typedef void (APIENTRYP PFNGLGETVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); -typedef void (APIENTRYP PFNGLGETVARIANTPOINTERVEXTPROC) (GLuint id, GLenum value, GLvoid **data); +typedef void (APIENTRYP PFNGLGETVARIANTPOINTERVEXTPROC) (GLuint id, GLenum value, void **data); typedef void (APIENTRYP PFNGLGETINVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); typedef void (APIENTRYP PFNGLGETINVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); typedef void (APIENTRYP PFNGLGETINVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); @@ -7790,8 +7815,8 @@ GLAPI void APIENTRY glWriteMaskEXT (GLuint res, GLuint in, GLenum outX, GLenum o GLAPI void APIENTRY glInsertComponentEXT (GLuint res, GLuint src, GLuint num); GLAPI void APIENTRY glExtractComponentEXT (GLuint res, GLuint src, GLuint num); GLAPI GLuint APIENTRY glGenSymbolsEXT (GLenum datatype, GLenum storagetype, GLenum range, GLuint components); -GLAPI void APIENTRY glSetInvariantEXT (GLuint id, GLenum type, const GLvoid *addr); -GLAPI void APIENTRY glSetLocalConstantEXT (GLuint id, GLenum type, const GLvoid *addr); +GLAPI void APIENTRY glSetInvariantEXT (GLuint id, GLenum type, const void *addr); +GLAPI void APIENTRY glSetLocalConstantEXT (GLuint id, GLenum type, const void *addr); GLAPI void APIENTRY glVariantbvEXT (GLuint id, const GLbyte *addr); GLAPI void APIENTRY glVariantsvEXT (GLuint id, const GLshort *addr); GLAPI void APIENTRY glVariantivEXT (GLuint id, const GLint *addr); @@ -7800,7 +7825,7 @@ GLAPI void APIENTRY glVariantdvEXT (GLuint id, const GLdouble *addr); GLAPI void APIENTRY glVariantubvEXT (GLuint id, const GLubyte *addr); GLAPI void APIENTRY glVariantusvEXT (GLuint id, const GLushort *addr); GLAPI void APIENTRY glVariantuivEXT (GLuint id, const GLuint *addr); -GLAPI void APIENTRY glVariantPointerEXT (GLuint id, GLenum type, GLuint stride, const GLvoid *addr); +GLAPI void APIENTRY glVariantPointerEXT (GLuint id, GLenum type, GLuint stride, const void *addr); GLAPI void APIENTRY glEnableVariantClientStateEXT (GLuint id); GLAPI void APIENTRY glDisableVariantClientStateEXT (GLuint id); GLAPI GLuint APIENTRY glBindLightParameterEXT (GLenum light, GLenum value); @@ -7812,7 +7837,7 @@ GLAPI GLboolean APIENTRY glIsVariantEnabledEXT (GLuint id, GLenum cap); GLAPI void APIENTRY glGetVariantBooleanvEXT (GLuint id, GLenum value, GLboolean *data); GLAPI void APIENTRY glGetVariantIntegervEXT (GLuint id, GLenum value, GLint *data); GLAPI void APIENTRY glGetVariantFloatvEXT (GLuint id, GLenum value, GLfloat *data); -GLAPI void APIENTRY glGetVariantPointervEXT (GLuint id, GLenum value, GLvoid **data); +GLAPI void APIENTRY glGetVariantPointervEXT (GLuint id, GLenum value, void **data); GLAPI void APIENTRY glGetInvariantBooleanvEXT (GLuint id, GLenum value, GLboolean *data); GLAPI void APIENTRY glGetInvariantIntegervEXT (GLuint id, GLenum value, GLint *data); GLAPI void APIENTRY glGetInvariantFloatvEXT (GLuint id, GLenum value, GLfloat *data); @@ -7839,11 +7864,11 @@ GLAPI void APIENTRY glGetLocalConstantFloatvEXT (GLuint id, GLenum value, GLfloa #define GL_VERTEX_WEIGHT_ARRAY_POINTER_EXT 0x8510 typedef void (APIENTRYP PFNGLVERTEXWEIGHTFEXTPROC) (GLfloat weight); typedef void (APIENTRYP PFNGLVERTEXWEIGHTFVEXTPROC) (const GLfloat *weight); -typedef void (APIENTRYP PFNGLVERTEXWEIGHTPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXWEIGHTPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const void *pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glVertexWeightfEXT (GLfloat weight); GLAPI void APIENTRY glVertexWeightfvEXT (const GLfloat *weight); -GLAPI void APIENTRY glVertexWeightPointerEXT (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glVertexWeightPointerEXT (GLint size, GLenum type, GLsizei stride, const void *pointer); #endif #endif /* GL_EXT_vertex_weighting */ @@ -7866,9 +7891,9 @@ GLAPI void APIENTRY glFrameTerminatorGREMEDY (void); #ifndef GL_GREMEDY_string_marker #define GL_GREMEDY_string_marker 1 -typedef void (APIENTRYP PFNGLSTRINGMARKERGREMEDYPROC) (GLsizei len, const GLvoid *string); +typedef void (APIENTRYP PFNGLSTRINGMARKERGREMEDYPROC) (GLsizei len, const void *string); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glStringMarkerGREMEDY (GLsizei len, const GLvoid *string); +GLAPI void APIENTRY glStringMarkerGREMEDY (GLsizei len, const void *string); #endif #endif /* GL_GREMEDY_string_marker */ @@ -7934,10 +7959,10 @@ GLAPI void APIENTRY glGetImageTransformParameterfvHP (GLenum target, GLenum pnam #ifndef GL_IBM_multimode_draw_arrays #define GL_IBM_multimode_draw_arrays 1 typedef void (APIENTRYP PFNGLMULTIMODEDRAWARRAYSIBMPROC) (const GLenum *mode, const GLint *first, const GLsizei *count, GLsizei primcount, GLint modestride); -typedef void (APIENTRYP PFNGLMULTIMODEDRAWELEMENTSIBMPROC) (const GLenum *mode, const GLsizei *count, GLenum type, const GLvoid *const*indices, GLsizei primcount, GLint modestride); +typedef void (APIENTRYP PFNGLMULTIMODEDRAWELEMENTSIBMPROC) (const GLenum *mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount, GLint modestride); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glMultiModeDrawArraysIBM (const GLenum *mode, const GLint *first, const GLsizei *count, GLsizei primcount, GLint modestride); -GLAPI void APIENTRY glMultiModeDrawElementsIBM (const GLenum *mode, const GLsizei *count, GLenum type, const GLvoid *const*indices, GLsizei primcount, GLint modestride); +GLAPI void APIENTRY glMultiModeDrawElementsIBM (const GLenum *mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount, GLint modestride); #endif #endif /* GL_IBM_multimode_draw_arrays */ @@ -7979,23 +8004,23 @@ GLAPI void APIENTRY glFlushStaticDataIBM (GLenum target); #define GL_EDGE_FLAG_ARRAY_LIST_STRIDE_IBM 103085 #define GL_FOG_COORDINATE_ARRAY_LIST_STRIDE_IBM 103086 #define GL_SECONDARY_COLOR_ARRAY_LIST_STRIDE_IBM 103087 -typedef void (APIENTRYP PFNGLCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); typedef void (APIENTRYP PFNGLEDGEFLAGPOINTERLISTIBMPROC) (GLint stride, const GLboolean **pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLFOGCOORDPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLINDEXPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLNORMALPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLTEXCOORDPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -typedef void (APIENTRYP PFNGLVERTEXPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLFOGCOORDPOINTERLISTIBMPROC) (GLenum type, GLint stride, const void **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLINDEXPOINTERLISTIBMPROC) (GLenum type, GLint stride, const void **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLNORMALPOINTERLISTIBMPROC) (GLenum type, GLint stride, const void **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLTEXCOORDPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLVERTEXPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorPointerListIBM (GLint size, GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -GLAPI void APIENTRY glSecondaryColorPointerListIBM (GLint size, GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); +GLAPI void APIENTRY glColorPointerListIBM (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); +GLAPI void APIENTRY glSecondaryColorPointerListIBM (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); GLAPI void APIENTRY glEdgeFlagPointerListIBM (GLint stride, const GLboolean **pointer, GLint ptrstride); -GLAPI void APIENTRY glFogCoordPointerListIBM (GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -GLAPI void APIENTRY glIndexPointerListIBM (GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -GLAPI void APIENTRY glNormalPointerListIBM (GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -GLAPI void APIENTRY glTexCoordPointerListIBM (GLint size, GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); -GLAPI void APIENTRY glVertexPointerListIBM (GLint size, GLenum type, GLint stride, const GLvoid **pointer, GLint ptrstride); +GLAPI void APIENTRY glFogCoordPointerListIBM (GLenum type, GLint stride, const void **pointer, GLint ptrstride); +GLAPI void APIENTRY glIndexPointerListIBM (GLenum type, GLint stride, const void **pointer, GLint ptrstride); +GLAPI void APIENTRY glNormalPointerListIBM (GLenum type, GLint stride, const void **pointer, GLint ptrstride); +GLAPI void APIENTRY glTexCoordPointerListIBM (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); +GLAPI void APIENTRY glVertexPointerListIBM (GLint size, GLenum type, GLint stride, const void **pointer, GLint ptrstride); #endif #endif /* GL_IBM_vertex_array_lists */ @@ -8032,11 +8057,11 @@ GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum sfactorRGB, GLenum dfactorRG #define GL_LAYOUT_LINEAR_CPU_CACHED_INTEL 2 typedef void (APIENTRYP PFNGLSYNCTEXTUREINTELPROC) (GLuint texture); typedef void (APIENTRYP PFNGLUNMAPTEXTURE2DINTELPROC) (GLuint texture, GLint level); -typedef void *(APIENTRYP PFNGLMAPTEXTURE2DINTELPROC) (GLuint texture, GLint level, GLbitfield access, const GLint *stride, const GLenum *layout); +typedef void *(APIENTRYP PFNGLMAPTEXTURE2DINTELPROC) (GLuint texture, GLint level, GLbitfield access, GLint *stride, GLenum *layout); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glSyncTextureINTEL (GLuint texture); GLAPI void APIENTRY glUnmapTexture2DINTEL (GLuint texture, GLint level); -GLAPI void *APIENTRY glMapTexture2DINTEL (GLuint texture, GLint level, GLbitfield access, const GLint *stride, const GLenum *layout); +GLAPI void *APIENTRY glMapTexture2DINTEL (GLuint texture, GLint level, GLbitfield access, GLint *stride, GLenum *layout); #endif #endif /* GL_INTEL_map_texture */ @@ -8047,15 +8072,15 @@ GLAPI void *APIENTRY glMapTexture2DINTEL (GLuint texture, GLint level, GLbitfiel #define GL_NORMAL_ARRAY_PARALLEL_POINTERS_INTEL 0x83F6 #define GL_COLOR_ARRAY_PARALLEL_POINTERS_INTEL 0x83F7 #define GL_TEXTURE_COORD_ARRAY_PARALLEL_POINTERS_INTEL 0x83F8 -typedef void (APIENTRYP PFNGLVERTEXPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid **pointer); -typedef void (APIENTRYP PFNGLNORMALPOINTERVINTELPROC) (GLenum type, const GLvoid **pointer); -typedef void (APIENTRYP PFNGLCOLORPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid **pointer); -typedef void (APIENTRYP PFNGLTEXCOORDPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid **pointer); +typedef void (APIENTRYP PFNGLVERTEXPOINTERVINTELPROC) (GLint size, GLenum type, const void **pointer); +typedef void (APIENTRYP PFNGLNORMALPOINTERVINTELPROC) (GLenum type, const void **pointer); +typedef void (APIENTRYP PFNGLCOLORPOINTERVINTELPROC) (GLint size, GLenum type, const void **pointer); +typedef void (APIENTRYP PFNGLTEXCOORDPOINTERVINTELPROC) (GLint size, GLenum type, const void **pointer); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVertexPointervINTEL (GLint size, GLenum type, const GLvoid **pointer); -GLAPI void APIENTRY glNormalPointervINTEL (GLenum type, const GLvoid **pointer); -GLAPI void APIENTRY glColorPointervINTEL (GLint size, GLenum type, const GLvoid **pointer); -GLAPI void APIENTRY glTexCoordPointervINTEL (GLint size, GLenum type, const GLvoid **pointer); +GLAPI void APIENTRY glVertexPointervINTEL (GLint size, GLenum type, const void **pointer); +GLAPI void APIENTRY glNormalPointervINTEL (GLenum type, const void **pointer); +GLAPI void APIENTRY glColorPointervINTEL (GLint size, GLenum type, const void **pointer); +GLAPI void APIENTRY glTexCoordPointervINTEL (GLint size, GLenum type, const void **pointer); #endif #endif /* GL_INTEL_parallel_arrays */ @@ -8155,11 +8180,11 @@ GLAPI void APIENTRY glEndConditionalRenderNVX (void); #ifndef GL_NV_bindless_multi_draw_indirect #define GL_NV_bindless_multi_draw_indirect 1 -typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTBINDLESSNVPROC) (GLenum mode, const GLvoid *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTBINDLESSNVPROC) (GLenum mode, GLenum type, const GLvoid *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTBINDLESSNVPROC) (GLenum mode, const void *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTBINDLESSNVPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glMultiDrawArraysIndirectBindlessNV (GLenum mode, const GLvoid *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); -GLAPI void APIENTRY glMultiDrawElementsIndirectBindlessNV (GLenum mode, GLenum type, const GLvoid *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); +GLAPI void APIENTRY glMultiDrawArraysIndirectBindlessNV (GLenum mode, const void *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); +GLAPI void APIENTRY glMultiDrawElementsIndirectBindlessNV (GLenum mode, GLenum type, const void *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); #endif #endif /* GL_NV_bindless_multi_draw_indirect */ @@ -8197,7 +8222,6 @@ GLAPI GLboolean APIENTRY glIsImageHandleResidentNV (GLuint64 handle); #ifndef GL_NV_blend_equation_advanced #define GL_NV_blend_equation_advanced 1 -#define GL_BLEND_ADVANCED_COHERENT_NV 0x9285 #define GL_BLEND_OVERLAP_NV 0x9281 #define GL_BLEND_PREMULTIPLIED_SRC_NV 0x9280 #define GL_COLORBURN_NV 0x929A @@ -8253,6 +8277,7 @@ GLAPI void APIENTRY glBlendBarrierNV (void); #ifndef GL_NV_blend_equation_advanced_coherent #define GL_NV_blend_equation_advanced_coherent 1 +#define GL_BLEND_ADVANCED_COHERENT_NV 0x9285 #endif /* GL_NV_blend_equation_advanced_coherent */ #ifndef GL_NV_blend_square @@ -8354,20 +8379,20 @@ GLAPI void APIENTRY glDrawTextureNV (GLuint texture, GLuint sampler, GLfloat x0, #define GL_EVAL_VERTEX_ATTRIB15_NV 0x86D5 #define GL_MAX_MAP_TESSELLATION_NV 0x86D6 #define GL_MAX_RATIONAL_EVAL_ORDER_NV 0x86D7 -typedef void (APIENTRYP PFNGLMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const GLvoid *points); +typedef void (APIENTRYP PFNGLMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const void *points); typedef void (APIENTRYP PFNGLMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, const GLfloat *params); -typedef void (APIENTRYP PFNGLGETMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, GLvoid *points); +typedef void (APIENTRYP PFNGLGETMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, void *points); typedef void (APIENTRYP PFNGLGETMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERIVNVPROC) (GLenum target, GLuint index, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLEVALMAPSNVPROC) (GLenum target, GLenum mode); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glMapControlPointsNV (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const GLvoid *points); +GLAPI void APIENTRY glMapControlPointsNV (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const void *points); GLAPI void APIENTRY glMapParameterivNV (GLenum target, GLenum pname, const GLint *params); GLAPI void APIENTRY glMapParameterfvNV (GLenum target, GLenum pname, const GLfloat *params); -GLAPI void APIENTRY glGetMapControlPointsNV (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, GLvoid *points); +GLAPI void APIENTRY glGetMapControlPointsNV (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, void *points); GLAPI void APIENTRY glGetMapParameterivNV (GLenum target, GLenum pname, GLint *params); GLAPI void APIENTRY glGetMapParameterfvNV (GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetMapAttribParameterivNV (GLenum target, GLuint index, GLenum pname, GLint *params); @@ -8991,13 +9016,13 @@ GLAPI void APIENTRY glProgramBufferParametersIuivNV (GLenum target, GLuint bindi typedef GLuint (APIENTRYP PFNGLGENPATHSNVPROC) (GLsizei range); typedef void (APIENTRYP PFNGLDELETEPATHSNVPROC) (GLuint path, GLsizei range); typedef GLboolean (APIENTRYP PFNGLISPATHNVPROC) (GLuint path); -typedef void (APIENTRYP PFNGLPATHCOMMANDSNVPROC) (GLuint path, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const GLvoid *coords); -typedef void (APIENTRYP PFNGLPATHCOORDSNVPROC) (GLuint path, GLsizei numCoords, GLenum coordType, const GLvoid *coords); -typedef void (APIENTRYP PFNGLPATHSUBCOMMANDSNVPROC) (GLuint path, GLsizei commandStart, GLsizei commandsToDelete, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const GLvoid *coords); -typedef void (APIENTRYP PFNGLPATHSUBCOORDSNVPROC) (GLuint path, GLsizei coordStart, GLsizei numCoords, GLenum coordType, const GLvoid *coords); -typedef void (APIENTRYP PFNGLPATHSTRINGNVPROC) (GLuint path, GLenum format, GLsizei length, const GLvoid *pathString); -typedef void (APIENTRYP PFNGLPATHGLYPHSNVPROC) (GLuint firstPathName, GLenum fontTarget, const GLvoid *fontName, GLbitfield fontStyle, GLsizei numGlyphs, GLenum type, const GLvoid *charcodes, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); -typedef void (APIENTRYP PFNGLPATHGLYPHRANGENVPROC) (GLuint firstPathName, GLenum fontTarget, const GLvoid *fontName, GLbitfield fontStyle, GLuint firstGlyph, GLsizei numGlyphs, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef void (APIENTRYP PFNGLPATHCOMMANDSNVPROC) (GLuint path, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (APIENTRYP PFNGLPATHCOORDSNVPROC) (GLuint path, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (APIENTRYP PFNGLPATHSUBCOMMANDSNVPROC) (GLuint path, GLsizei commandStart, GLsizei commandsToDelete, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (APIENTRYP PFNGLPATHSUBCOORDSNVPROC) (GLuint path, GLsizei coordStart, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (APIENTRYP PFNGLPATHSTRINGNVPROC) (GLuint path, GLenum format, GLsizei length, const void *pathString); +typedef void (APIENTRYP PFNGLPATHGLYPHSNVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLsizei numGlyphs, GLenum type, const void *charcodes, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef void (APIENTRYP PFNGLPATHGLYPHRANGENVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyph, GLsizei numGlyphs, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); typedef void (APIENTRYP PFNGLWEIGHTPATHSNVPROC) (GLuint resultPath, GLsizei numPaths, const GLuint *paths, const GLfloat *weights); typedef void (APIENTRYP PFNGLCOPYPATHNVPROC) (GLuint resultPath, GLuint srcPath); typedef void (APIENTRYP PFNGLINTERPOLATEPATHSNVPROC) (GLuint resultPath, GLuint pathA, GLuint pathB, GLfloat weight); @@ -9011,24 +9036,24 @@ typedef void (APIENTRYP PFNGLPATHSTENCILFUNCNVPROC) (GLenum func, GLint ref, GLu typedef void (APIENTRYP PFNGLPATHSTENCILDEPTHOFFSETNVPROC) (GLfloat factor, GLfloat units); typedef void (APIENTRYP PFNGLSTENCILFILLPATHNVPROC) (GLuint path, GLenum fillMode, GLuint mask); typedef void (APIENTRYP PFNGLSTENCILSTROKEPATHNVPROC) (GLuint path, GLint reference, GLuint mask); -typedef void (APIENTRYP PFNGLSTENCILFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum transformType, const GLfloat *transformValues); -typedef void (APIENTRYP PFNGLSTENCILSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLSTENCILFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLSTENCILSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum transformType, const GLfloat *transformValues); typedef void (APIENTRYP PFNGLPATHCOVERDEPTHFUNCNVPROC) (GLenum func); typedef void (APIENTRYP PFNGLPATHCOLORGENNVPROC) (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs); typedef void (APIENTRYP PFNGLPATHTEXGENNVPROC) (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs); typedef void (APIENTRYP PFNGLPATHFOGGENNVPROC) (GLenum genMode); typedef void (APIENTRYP PFNGLCOVERFILLPATHNVPROC) (GLuint path, GLenum coverMode); typedef void (APIENTRYP PFNGLCOVERSTROKEPATHNVPROC) (GLuint path, GLenum coverMode); -typedef void (APIENTRYP PFNGLCOVERFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); -typedef void (APIENTRYP PFNGLCOVERSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLCOVERFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLCOVERSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); typedef void (APIENTRYP PFNGLGETPATHPARAMETERIVNVPROC) (GLuint path, GLenum pname, GLint *value); typedef void (APIENTRYP PFNGLGETPATHPARAMETERFVNVPROC) (GLuint path, GLenum pname, GLfloat *value); typedef void (APIENTRYP PFNGLGETPATHCOMMANDSNVPROC) (GLuint path, GLubyte *commands); typedef void (APIENTRYP PFNGLGETPATHCOORDSNVPROC) (GLuint path, GLfloat *coords); typedef void (APIENTRYP PFNGLGETPATHDASHARRAYNVPROC) (GLuint path, GLfloat *dashArray); -typedef void (APIENTRYP PFNGLGETPATHMETRICSNVPROC) (GLbitfield metricQueryMask, GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLsizei stride, GLfloat *metrics); +typedef void (APIENTRYP PFNGLGETPATHMETRICSNVPROC) (GLbitfield metricQueryMask, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLsizei stride, GLfloat *metrics); typedef void (APIENTRYP PFNGLGETPATHMETRICRANGENVPROC) (GLbitfield metricQueryMask, GLuint firstPathName, GLsizei numPaths, GLsizei stride, GLfloat *metrics); -typedef void (APIENTRYP PFNGLGETPATHSPACINGNVPROC) (GLenum pathListMode, GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLfloat advanceScale, GLfloat kerningScale, GLenum transformType, GLfloat *returnedSpacing); +typedef void (APIENTRYP PFNGLGETPATHSPACINGNVPROC) (GLenum pathListMode, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLfloat advanceScale, GLfloat kerningScale, GLenum transformType, GLfloat *returnedSpacing); typedef void (APIENTRYP PFNGLGETPATHCOLORGENIVNVPROC) (GLenum color, GLenum pname, GLint *value); typedef void (APIENTRYP PFNGLGETPATHCOLORGENFVNVPROC) (GLenum color, GLenum pname, GLfloat *value); typedef void (APIENTRYP PFNGLGETPATHTEXGENIVNVPROC) (GLenum texCoordSet, GLenum pname, GLint *value); @@ -9041,13 +9066,13 @@ typedef GLboolean (APIENTRYP PFNGLPOINTALONGPATHNVPROC) (GLuint path, GLsizei st GLAPI GLuint APIENTRY glGenPathsNV (GLsizei range); GLAPI void APIENTRY glDeletePathsNV (GLuint path, GLsizei range); GLAPI GLboolean APIENTRY glIsPathNV (GLuint path); -GLAPI void APIENTRY glPathCommandsNV (GLuint path, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const GLvoid *coords); -GLAPI void APIENTRY glPathCoordsNV (GLuint path, GLsizei numCoords, GLenum coordType, const GLvoid *coords); -GLAPI void APIENTRY glPathSubCommandsNV (GLuint path, GLsizei commandStart, GLsizei commandsToDelete, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const GLvoid *coords); -GLAPI void APIENTRY glPathSubCoordsNV (GLuint path, GLsizei coordStart, GLsizei numCoords, GLenum coordType, const GLvoid *coords); -GLAPI void APIENTRY glPathStringNV (GLuint path, GLenum format, GLsizei length, const GLvoid *pathString); -GLAPI void APIENTRY glPathGlyphsNV (GLuint firstPathName, GLenum fontTarget, const GLvoid *fontName, GLbitfield fontStyle, GLsizei numGlyphs, GLenum type, const GLvoid *charcodes, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); -GLAPI void APIENTRY glPathGlyphRangeNV (GLuint firstPathName, GLenum fontTarget, const GLvoid *fontName, GLbitfield fontStyle, GLuint firstGlyph, GLsizei numGlyphs, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GLAPI void APIENTRY glPathCommandsNV (GLuint path, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +GLAPI void APIENTRY glPathCoordsNV (GLuint path, GLsizei numCoords, GLenum coordType, const void *coords); +GLAPI void APIENTRY glPathSubCommandsNV (GLuint path, GLsizei commandStart, GLsizei commandsToDelete, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +GLAPI void APIENTRY glPathSubCoordsNV (GLuint path, GLsizei coordStart, GLsizei numCoords, GLenum coordType, const void *coords); +GLAPI void APIENTRY glPathStringNV (GLuint path, GLenum format, GLsizei length, const void *pathString); +GLAPI void APIENTRY glPathGlyphsNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLsizei numGlyphs, GLenum type, const void *charcodes, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GLAPI void APIENTRY glPathGlyphRangeNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyph, GLsizei numGlyphs, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); GLAPI void APIENTRY glWeightPathsNV (GLuint resultPath, GLsizei numPaths, const GLuint *paths, const GLfloat *weights); GLAPI void APIENTRY glCopyPathNV (GLuint resultPath, GLuint srcPath); GLAPI void APIENTRY glInterpolatePathsNV (GLuint resultPath, GLuint pathA, GLuint pathB, GLfloat weight); @@ -9061,24 +9086,24 @@ GLAPI void APIENTRY glPathStencilFuncNV (GLenum func, GLint ref, GLuint mask); GLAPI void APIENTRY glPathStencilDepthOffsetNV (GLfloat factor, GLfloat units); GLAPI void APIENTRY glStencilFillPathNV (GLuint path, GLenum fillMode, GLuint mask); GLAPI void APIENTRY glStencilStrokePathNV (GLuint path, GLint reference, GLuint mask); -GLAPI void APIENTRY glStencilFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum transformType, const GLfloat *transformValues); -GLAPI void APIENTRY glStencilStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glStencilFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glStencilStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum transformType, const GLfloat *transformValues); GLAPI void APIENTRY glPathCoverDepthFuncNV (GLenum func); GLAPI void APIENTRY glPathColorGenNV (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs); GLAPI void APIENTRY glPathTexGenNV (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs); GLAPI void APIENTRY glPathFogGenNV (GLenum genMode); GLAPI void APIENTRY glCoverFillPathNV (GLuint path, GLenum coverMode); GLAPI void APIENTRY glCoverStrokePathNV (GLuint path, GLenum coverMode); -GLAPI void APIENTRY glCoverFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); -GLAPI void APIENTRY glCoverStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glCoverFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glCoverStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); GLAPI void APIENTRY glGetPathParameterivNV (GLuint path, GLenum pname, GLint *value); GLAPI void APIENTRY glGetPathParameterfvNV (GLuint path, GLenum pname, GLfloat *value); GLAPI void APIENTRY glGetPathCommandsNV (GLuint path, GLubyte *commands); GLAPI void APIENTRY glGetPathCoordsNV (GLuint path, GLfloat *coords); GLAPI void APIENTRY glGetPathDashArrayNV (GLuint path, GLfloat *dashArray); -GLAPI void APIENTRY glGetPathMetricsNV (GLbitfield metricQueryMask, GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLsizei stride, GLfloat *metrics); +GLAPI void APIENTRY glGetPathMetricsNV (GLbitfield metricQueryMask, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLsizei stride, GLfloat *metrics); GLAPI void APIENTRY glGetPathMetricRangeNV (GLbitfield metricQueryMask, GLuint firstPathName, GLsizei numPaths, GLsizei stride, GLfloat *metrics); -GLAPI void APIENTRY glGetPathSpacingNV (GLenum pathListMode, GLsizei numPaths, GLenum pathNameType, const GLvoid *paths, GLuint pathBase, GLfloat advanceScale, GLfloat kerningScale, GLenum transformType, GLfloat *returnedSpacing); +GLAPI void APIENTRY glGetPathSpacingNV (GLenum pathListMode, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLfloat advanceScale, GLfloat kerningScale, GLenum transformType, GLfloat *returnedSpacing); GLAPI void APIENTRY glGetPathColorGenivNV (GLenum color, GLenum pname, GLint *value); GLAPI void APIENTRY glGetPathColorGenfvNV (GLenum color, GLenum pname, GLfloat *value); GLAPI void APIENTRY glGetPathTexGenivNV (GLenum texCoordSet, GLenum pname, GLint *value); @@ -9098,10 +9123,10 @@ GLAPI GLboolean APIENTRY glPointAlongPathNV (GLuint path, GLsizei startSegment, #define GL_READ_PIXEL_DATA_RANGE_LENGTH_NV 0x887B #define GL_WRITE_PIXEL_DATA_RANGE_POINTER_NV 0x887C #define GL_READ_PIXEL_DATA_RANGE_POINTER_NV 0x887D -typedef void (APIENTRYP PFNGLPIXELDATARANGENVPROC) (GLenum target, GLsizei length, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLPIXELDATARANGENVPROC) (GLenum target, GLsizei length, const void *pointer); typedef void (APIENTRYP PFNGLFLUSHPIXELDATARANGENVPROC) (GLenum target); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glPixelDataRangeNV (GLenum target, GLsizei length, const GLvoid *pointer); +GLAPI void APIENTRY glPixelDataRangeNV (GLenum target, GLsizei length, const void *pointer); GLAPI void APIENTRY glFlushPixelDataRangeNV (GLenum target); #endif #endif /* GL_NV_pixel_data_range */ @@ -9572,10 +9597,10 @@ typedef GLintptr GLvdpauSurfaceNV; #define GL_SURFACE_REGISTERED_NV 0x86FD #define GL_SURFACE_MAPPED_NV 0x8700 #define GL_WRITE_DISCARD_NV 0x88BE -typedef void (APIENTRYP PFNGLVDPAUINITNVPROC) (const GLvoid *vdpDevice, const GLvoid *getProcAddress); +typedef void (APIENTRYP PFNGLVDPAUINITNVPROC) (const void *vdpDevice, const void *getProcAddress); typedef void (APIENTRYP PFNGLVDPAUFININVPROC) (void); -typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTERVIDEOSURFACENVPROC) (const GLvoid *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); -typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTEROUTPUTSURFACENVPROC) (const GLvoid *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); +typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTERVIDEOSURFACENVPROC) (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); +typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTEROUTPUTSURFACENVPROC) (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); typedef void (APIENTRYP PFNGLVDPAUISSURFACENVPROC) (GLvdpauSurfaceNV surface); typedef void (APIENTRYP PFNGLVDPAUUNREGISTERSURFACENVPROC) (GLvdpauSurfaceNV surface); typedef void (APIENTRYP PFNGLVDPAUGETSURFACEIVNVPROC) (GLvdpauSurfaceNV surface, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); @@ -9583,10 +9608,10 @@ typedef void (APIENTRYP PFNGLVDPAUSURFACEACCESSNVPROC) (GLvdpauSurfaceNV surface typedef void (APIENTRYP PFNGLVDPAUMAPSURFACESNVPROC) (GLsizei numSurfaces, const GLvdpauSurfaceNV *surfaces); typedef void (APIENTRYP PFNGLVDPAUUNMAPSURFACESNVPROC) (GLsizei numSurface, const GLvdpauSurfaceNV *surfaces); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glVDPAUInitNV (const GLvoid *vdpDevice, const GLvoid *getProcAddress); +GLAPI void APIENTRY glVDPAUInitNV (const void *vdpDevice, const void *getProcAddress); GLAPI void APIENTRY glVDPAUFiniNV (void); -GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterVideoSurfaceNV (const GLvoid *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); -GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterOutputSurfaceNV (const GLvoid *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); +GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterVideoSurfaceNV (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); +GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterOutputSurfaceNV (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); GLAPI void APIENTRY glVDPAUIsSurfaceNV (GLvdpauSurfaceNV surface); GLAPI void APIENTRY glVDPAUUnregisterSurfaceNV (GLvdpauSurfaceNV surface); GLAPI void APIENTRY glVDPAUGetSurfaceivNV (GLvdpauSurfaceNV surface, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); @@ -9604,10 +9629,10 @@ GLAPI void APIENTRY glVDPAUUnmapSurfacesNV (GLsizei numSurface, const GLvdpauSur #define GL_MAX_VERTEX_ARRAY_RANGE_ELEMENT_NV 0x8520 #define GL_VERTEX_ARRAY_RANGE_POINTER_NV 0x8521 typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGENVPROC) (void); -typedef void (APIENTRYP PFNGLVERTEXARRAYRANGENVPROC) (GLsizei length, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXARRAYRANGENVPROC) (GLsizei length, const void *pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glFlushVertexArrayRangeNV (void); -GLAPI void APIENTRY glVertexArrayRangeNV (GLsizei length, const GLvoid *pointer); +GLAPI void APIENTRY glVertexArrayRangeNV (GLsizei length, const void *pointer); #endif #endif /* GL_NV_vertex_array_range */ @@ -9813,7 +9838,7 @@ typedef void (APIENTRYP PFNGLGETTRACKMATRIXIVNVPROC) (GLenum target, GLuint addr typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVNVPROC) (GLuint index, GLenum pname, GLdouble *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVNVPROC) (GLuint index, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVNVPROC) (GLuint index, GLenum pname, GLint *params); -typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVNVPROC) (GLuint index, GLenum pname, GLvoid **pointer); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVNVPROC) (GLuint index, GLenum pname, void **pointer); typedef GLboolean (APIENTRYP PFNGLISPROGRAMNVPROC) (GLuint id); typedef void (APIENTRYP PFNGLLOADPROGRAMNVPROC) (GLenum target, GLuint id, GLsizei len, const GLubyte *program); typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DNVPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); @@ -9824,7 +9849,7 @@ typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4DVNVPROC) (GLenum target, GLuint typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4FVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLfloat *v); typedef void (APIENTRYP PFNGLREQUESTRESIDENTPROGRAMSNVPROC) (GLsizei n, const GLuint *programs); typedef void (APIENTRYP PFNGLTRACKMATRIXNVPROC) (GLenum target, GLuint address, GLenum matrix, GLenum transform); -typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERNVPROC) (GLuint index, GLint fsize, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERNVPROC) (GLuint index, GLint fsize, GLenum type, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLVERTEXATTRIB1DNVPROC) (GLuint index, GLdouble x); typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVNVPROC) (GLuint index, const GLdouble *v); typedef void (APIENTRYP PFNGLVERTEXATTRIB1FNVPROC) (GLuint index, GLfloat x); @@ -9878,7 +9903,7 @@ GLAPI void APIENTRY glGetTrackMatrixivNV (GLenum target, GLuint address, GLenum GLAPI void APIENTRY glGetVertexAttribdvNV (GLuint index, GLenum pname, GLdouble *params); GLAPI void APIENTRY glGetVertexAttribfvNV (GLuint index, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetVertexAttribivNV (GLuint index, GLenum pname, GLint *params); -GLAPI void APIENTRY glGetVertexAttribPointervNV (GLuint index, GLenum pname, GLvoid **pointer); +GLAPI void APIENTRY glGetVertexAttribPointervNV (GLuint index, GLenum pname, void **pointer); GLAPI GLboolean APIENTRY glIsProgramNV (GLuint id); GLAPI void APIENTRY glLoadProgramNV (GLenum target, GLuint id, GLsizei len, const GLubyte *program); GLAPI void APIENTRY glProgramParameter4dNV (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); @@ -9889,7 +9914,7 @@ GLAPI void APIENTRY glProgramParameters4dvNV (GLenum target, GLuint index, GLsiz GLAPI void APIENTRY glProgramParameters4fvNV (GLenum target, GLuint index, GLsizei count, const GLfloat *v); GLAPI void APIENTRY glRequestResidentProgramsNV (GLsizei n, const GLuint *programs); GLAPI void APIENTRY glTrackMatrixNV (GLenum target, GLuint address, GLenum matrix, GLenum transform); -GLAPI void APIENTRY glVertexAttribPointerNV (GLuint index, GLint fsize, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glVertexAttribPointerNV (GLuint index, GLint fsize, GLenum type, GLsizei stride, const void *pointer); GLAPI void APIENTRY glVertexAttrib1dNV (GLuint index, GLdouble x); GLAPI void APIENTRY glVertexAttrib1dvNV (GLuint index, const GLdouble *v); GLAPI void APIENTRY glVertexAttrib1fNV (GLuint index, GLfloat x); @@ -9971,7 +9996,7 @@ typedef void (APIENTRYP PFNGLVERTEXATTRIBI4BVEXTPROC) (GLuint index, const GLbyt typedef void (APIENTRYP PFNGLVERTEXATTRIBI4SVEXTPROC) (GLuint index, const GLshort *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UBVEXTPROC) (GLuint index, const GLubyte *v); typedef void (APIENTRYP PFNGLVERTEXATTRIBI4USVEXTPROC) (GLuint index, const GLushort *v); -typedef void (APIENTRYP PFNGLVERTEXATTRIBIPOINTEREXTPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXATTRIBIPOINTEREXTPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIIVEXTPROC) (GLuint index, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIUIVEXTPROC) (GLuint index, GLenum pname, GLuint *params); #ifdef GL_GLEXT_PROTOTYPES @@ -9995,7 +10020,7 @@ GLAPI void APIENTRY glVertexAttribI4bvEXT (GLuint index, const GLbyte *v); GLAPI void APIENTRY glVertexAttribI4svEXT (GLuint index, const GLshort *v); GLAPI void APIENTRY glVertexAttribI4ubvEXT (GLuint index, const GLubyte *v); GLAPI void APIENTRY glVertexAttribI4usvEXT (GLuint index, const GLushort *v); -GLAPI void APIENTRY glVertexAttribIPointerEXT (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glVertexAttribIPointerEXT (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); GLAPI void APIENTRY glGetVertexAttribIivEXT (GLuint index, GLenum pname, GLint *params); GLAPI void APIENTRY glGetVertexAttribIuivEXT (GLuint index, GLenum pname, GLuint *params); #endif @@ -10289,11 +10314,11 @@ GLAPI void APIENTRY glGetSharpenTexFuncSGIS (GLenum target, GLfloat *points); #define GL_TEXTURE_WRAP_Q_SGIS 0x8137 #define GL_MAX_4D_TEXTURE_SIZE_SGIS 0x8138 #define GL_TEXTURE_4D_BINDING_SGIS 0x814F -typedef void (APIENTRYP PFNGLTEXIMAGE4DSGISPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -typedef void (APIENTRYP PFNGLTEXSUBIMAGE4DSGISPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXIMAGE4DSGISPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE4DSGISPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const void *pixels); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glTexImage4DSGIS (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const GLvoid *pixels); -GLAPI void APIENTRY glTexSubImage4DSGIS (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glTexImage4DSGIS (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTexSubImage4DSGIS (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const void *pixels); #endif #endif /* GL_SGIS_texture4D */ @@ -10529,9 +10554,9 @@ GLAPI void APIENTRY glFrameZoomSGIX (GLint factor); #ifndef GL_SGIX_igloo_interface #define GL_SGIX_igloo_interface 1 -typedef void (APIENTRYP PFNGLIGLOOINTERFACESGIXPROC) (GLenum pname, const GLvoid *params); +typedef void (APIENTRYP PFNGLIGLOOINTERFACESGIXPROC) (GLenum pname, const void *params); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glIglooInterfaceSGIX (GLenum pname, const GLvoid *params); +GLAPI void APIENTRY glIglooInterfaceSGIX (GLenum pname, const void *params); #endif #endif /* GL_SGIX_igloo_interface */ @@ -10788,19 +10813,19 @@ GLAPI void APIENTRY glTagSampleBufferSGIX (void); #define GL_COLOR_TABLE_ALPHA_SIZE_SGI 0x80DD #define GL_COLOR_TABLE_LUMINANCE_SIZE_SGI 0x80DE #define GL_COLOR_TABLE_INTENSITY_SIZE_SGI 0x80DF -typedef void (APIENTRYP PFNGLCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); +typedef void (APIENTRYP PFNGLCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *table); typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, const GLfloat *params); typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, const GLint *params); typedef void (APIENTRYP PFNGLCOPYCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); -typedef void (APIENTRYP PFNGLGETCOLORTABLESGIPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table); +typedef void (APIENTRYP PFNGLGETCOLORTABLESGIPROC) (GLenum target, GLenum format, GLenum type, void *table); typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, GLfloat *params); typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, GLint *params); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glColorTableSGI (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); +GLAPI void APIENTRY glColorTableSGI (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void *table); GLAPI void APIENTRY glColorTableParameterfvSGI (GLenum target, GLenum pname, const GLfloat *params); GLAPI void APIENTRY glColorTableParameterivSGI (GLenum target, GLenum pname, const GLint *params); GLAPI void APIENTRY glCopyColorTableSGI (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); -GLAPI void APIENTRY glGetColorTableSGI (GLenum target, GLenum format, GLenum type, GLvoid *table); +GLAPI void APIENTRY glGetColorTableSGI (GLenum target, GLenum format, GLenum type, void *table); GLAPI void APIENTRY glGetColorTableParameterfvSGI (GLenum target, GLenum pname, GLfloat *params); GLAPI void APIENTRY glGetColorTableParameterivSGI (GLenum target, GLenum pname, GLint *params); #endif @@ -10891,7 +10916,7 @@ typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBSUNPROC) (GLubyte code); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVSUNPROC) (const GLuint *code); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSVSUNPROC) (const GLushort *code); typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBVSUNPROC) (const GLubyte *code); -typedef void (APIENTRYP PFNGLREPLACEMENTCODEPOINTERSUNPROC) (GLenum type, GLsizei stride, const GLvoid **pointer); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEPOINTERSUNPROC) (GLenum type, GLsizei stride, const void **pointer); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glReplacementCodeuiSUN (GLuint code); GLAPI void APIENTRY glReplacementCodeusSUN (GLushort code); @@ -10899,7 +10924,7 @@ GLAPI void APIENTRY glReplacementCodeubSUN (GLubyte code); GLAPI void APIENTRY glReplacementCodeuivSUN (const GLuint *code); GLAPI void APIENTRY glReplacementCodeusvSUN (const GLushort *code); GLAPI void APIENTRY glReplacementCodeubvSUN (const GLubyte *code); -GLAPI void APIENTRY glReplacementCodePointerSUN (GLenum type, GLsizei stride, const GLvoid **pointer); +GLAPI void APIENTRY glReplacementCodePointerSUN (GLenum type, GLsizei stride, const void **pointer); #endif #endif /* GL_SUN_triangle_list */ diff --git a/extern/glfw/deps/GL/glxext.h b/extern/glfw/deps/GL/glxext.h index 992e065..40aa2c3 100644 --- a/extern/glfw/deps/GL/glxext.h +++ b/extern/glfw/deps/GL/glxext.h @@ -33,10 +33,10 @@ extern "C" { ** used to make the header, and the header can be found at ** http://www.opengl.org/registry/ ** -** Khronos $Revision$ on $Date$ +** Khronos $Revision: 23649 $ on $Date: 2013-10-23 00:21:49 -0700 (Wed, 23 Oct 2013) $ */ -#define GLX_GLXEXT_VERSION 20130710 +#define GLX_GLXEXT_VERSION 20131008 /* Generated C header for: * API: glx diff --git a/extern/glfw/deps/GL/wglext.h b/extern/glfw/deps/GL/wglext.h index c235685..dc73a01 100644 --- a/extern/glfw/deps/GL/wglext.h +++ b/extern/glfw/deps/GL/wglext.h @@ -33,7 +33,7 @@ extern "C" { ** used to make the header, and the header can be found at ** http://www.opengl.org/registry/ ** -** Khronos $Revision$ on $Date$ +** Khronos $Revision: 23649 $ on $Date: 2013-10-23 00:21:49 -0700 (Wed, 23 Oct 2013) $ */ #if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__) @@ -41,7 +41,7 @@ extern "C" { #include #endif -#define WGL_WGLEXT_VERSION 20130710 +#define WGL_WGLEXT_VERSION 20130916 /* Generated C header for: * API: wgl @@ -645,6 +645,14 @@ BOOL WINAPI wglCopyImageSubDataNV (HGLRC hSrcRC, GLuint srcName, GLenum srcTarge #endif #endif /* WGL_NV_copy_image */ +#ifndef WGL_NV_delay_before_swap +#define WGL_NV_delay_before_swap 1 +typedef BOOL (WINAPI * PFNWGLDELAYBEFORESWAPNVPROC) (HDC hDC, GLfloat seconds); +#ifdef WGL_WGLEXT_PROTOTYPES +BOOL WINAPI wglDelayBeforeSwapNV (HDC hDC, GLfloat seconds); +#endif +#endif /* WGL_NV_delay_before_swap */ + #ifndef WGL_NV_float_buffer #define WGL_NV_float_buffer 1 #define WGL_FLOAT_COMPONENTS_NV 0x20B0 diff --git a/extern/glfw/docs/CMakeLists.txt b/extern/glfw/docs/CMakeLists.txt index bad6bf8..45a6162 100644 --- a/extern/glfw/docs/CMakeLists.txt +++ b/extern/glfw/docs/CMakeLists.txt @@ -1,5 +1,5 @@ - -add_custom_target(docs ALL ${DOXYGEN_EXECUTABLE} - WORKING_DIRECTORY ${GLFW_BINARY_DIR}/docs - COMMENT "Generating HTML documentation" VERBATIM) - + +add_custom_target(docs ALL ${DOXYGEN_EXECUTABLE} + WORKING_DIRECTORY ${GLFW_BINARY_DIR}/docs + COMMENT "Generating HTML documentation" VERBATIM) + diff --git a/extern/glfw/docs/Doxyfile.in b/extern/glfw/docs/Doxyfile.in index 7c3c431..ed6c658 100644 --- a/extern/glfw/docs/Doxyfile.in +++ b/extern/glfw/docs/Doxyfile.in @@ -659,6 +659,7 @@ INPUT = @GLFW_INTERNAL_DOCS@ \ @GLFW_SOURCE_DIR@/docs/news.dox \ @GLFW_SOURCE_DIR@/docs/quick.dox \ @GLFW_SOURCE_DIR@/docs/moving.dox \ + @GLFW_SOURCE_DIR@/docs/compile.dox \ @GLFW_SOURCE_DIR@/docs/build.dox \ @GLFW_SOURCE_DIR@/docs/context.dox \ @GLFW_SOURCE_DIR@/docs/monitor.dox \ @@ -899,13 +900,13 @@ HTML_FILE_EXTENSION = .html # have to redo this when upgrading to a newer version of doxygen or when # changing the value of configuration settings such as GENERATE_TREEVIEW! -HTML_HEADER = +HTML_HEADER = @GLFW_SOURCE_DIR@/docs/header.html # The HTML_FOOTER tag can be used to specify a personal HTML footer for # each generated HTML page. If it is left blank doxygen will generate a # standard footer. -HTML_FOOTER = +HTML_FOOTER = @GLFW_SOURCE_DIR@/docs/footer.html # The HTML_STYLESHEET tag can be used to specify a user-defined cascading # style sheet that is used by each HTML page. It can be used to @@ -924,7 +925,7 @@ HTML_STYLESHEET = # robust against future updates. Doxygen will copy the style sheet file to # the output directory. -HTML_EXTRA_STYLESHEET = +HTML_EXTRA_STYLESHEET = @GLFW_SOURCE_DIR@/docs/extra.css # The HTML_EXTRA_FILES tag can be used to specify one or more extra images or # other source files which should be copied to the HTML output directory. Note diff --git a/extern/glfw/docs/build.dox b/extern/glfw/docs/build.dox index e9ecaf5..c4594cd 100644 --- a/extern/glfw/docs/build.dox +++ b/extern/glfw/docs/build.dox @@ -1,11 +1,13 @@ /*! -@page build Building programs using GLFW +@page build Building programs that use GLFW @tableofcontents This is about compiling and linking programs that use GLFW. For information on -how to *write* such programs, start with the [introductory tutorial](@ref quick). +how to write such programs, start with the [introductory tutorial](@ref quick). +For information on how to compile the GLFW library itself, see the @ref compile +guide. @section build_include Including the GLFW header file @@ -48,7 +50,9 @@ header that the GLFW header includes and GLEW will work as expected. @subsection build_macros GLFW header option macros These macros may be defined before the inclusion of the GLFW header and affect -how that header behaves. +the behavior of the header. Note that GLFW does not provide any of the OpenGL +or OpenGL ES headers mentioned below. These are provided by your development +environment or your OpenGL or OpenGL ES SDK. `GLFW_INCLUDE_GLCOREARB` makes the header include the modern `GL/glcorearb.h` header (`OpenGL/gl3.h` on OS X) instead of the regular OpenGL header. @@ -81,8 +85,10 @@ The static version of the GLFW library is named `glfw3`. When using this version, it is also necessary to link with some libraries that GLFW uses. When linking a program under Windows that uses the static version of GLFW, you -must link with `opengl32`. If you are using GLU, you must also link with -`glu32`. +must link with `opengl32`. On some versions of MinGW, you must also explicitly +link with `gdi32`, while other versions of MinGW include it in the set of +default libraries along with other dependencies like `user32` and `kernel32`. +If you are using GLU, you must also link with `glu32`. The link library for the GLFW DLL is named `glfw3dll`. When compiling a program that uses the DLL version of GLFW, you need to define the `GLFW_DLL` macro @@ -158,7 +164,7 @@ If you are using the static library version of GLFW, use the @subsection build_link_pkgconfig With pkg-config on OS X or other Unix GLFW supports [pkg-config](http://www.freedesktop.org/wiki/Software/pkg-config/), -and `glfw3.pc` file is generated when the GLFW library is built and installed +and the `glfw3.pc` file is generated when the GLFW library is built and installed along with it. A typical compile and link command-line when using the static may look like this: @@ -189,7 +195,7 @@ If you are using the dynamic library version of GLFW, simply add it to the project dependencies. If you are using the static library version of GLFW, add it and the Cocoa, -OpenGL and IOKit frameworks to the project as dependencies. +OpenGL, IOKit and CoreVideo frameworks to the project as dependencies. @subsection build_link_osx With command-line on OS X @@ -198,7 +204,7 @@ If you do not wish to use pkg-config, you need to add the required frameworks and libraries to your command-line using the `-l` and `-framework` switches, i.e.: - cc -o myprog myprog.c -lglfw -framework Cocoa -framework OpenGL -framework IOKit + cc -o myprog myprog.c -lglfw -framework Cocoa -framework OpenGL -framework IOKit -framework CoreVideo Note that you do not add the `.framework` extension to a framework when adding it from the command-line. diff --git a/extern/glfw/docs/compat.dox b/extern/glfw/docs/compat.dox index 9f78f47..e14263f 100644 --- a/extern/glfw/docs/compat.dox +++ b/extern/glfw/docs/compat.dox @@ -123,15 +123,15 @@ version 2.1. Because of this, on OS X 10.7 and later, the `GLFW_CONTEXT_VERSION_MAJOR` and `GLFW_CONTEXT_VERSION_MINOR` hints will cause @ref glfwCreateWindow to fail if -given version 3.0 or 3.1, the `GLFW_OPENGL_FORWARD_COMPAT` is required for -creating contexts for OpenGL 3.2 and later, the `GLFW_OPENGL_DEBUG_CONTEXT` hint -is ignored and setting the `GLFW_OPENGL_PROFILE` hint to anything except -`GLFW_OPENGL_CORE_PROFILE` will cause @ref glfwCreateWindow to fail. +given version 3.0 or 3.1, the `GLFW_OPENGL_FORWARD_COMPAT` hint must be set to +non-zero and the `GLFW_OPENGL_PROFILE` hint must be set to +`GLFW_OPENGL_CORE_PROFILE` when creating OpenGL 3.2 and later contexts and the +`GLFW_OPENGL_DEBUG_CONTEXT` hint is ignored. Also, on Mac OS X 10.6 and below, the `GLFW_CONTEXT_VERSION_MAJOR` and -`GLFW_CONTEXT_VERSION_MINOR` hints will fail if given a version above 2.1, the -`GLFW_OPENGL_DEBUG_CONTEXT` hint will have no effect, and setting the -`GLFW_OPENGL_PROFILE` or `GLFW_OPENGL_FORWARD_COMPAT` hints to a non-zero value -will cause @ref glfwCreateWindow to fail. +`GLFW_CONTEXT_VERSION_MINOR` hints will fail if given a version above 2.1, +setting the `GLFW_OPENGL_PROFILE` or `GLFW_OPENGL_FORWARD_COMPAT` hints to +a non-default value will cause @ref glfwCreateWindow to fail and the +`GLFW_OPENGL_DEBUG_CONTEXT` hint is ignored. */ diff --git a/extern/glfw/docs/compile.dox b/extern/glfw/docs/compile.dox new file mode 100644 index 0000000..ef6c3b9 --- /dev/null +++ b/extern/glfw/docs/compile.dox @@ -0,0 +1,261 @@ +/*! + +@page compile Compiling GLFW + +@tableofcontents + +This is about compiling the GLFW library itself. For information on how to +build programs that use GLFW, see the @ref build guide. + + +@section compile_deps Dependencies + +To compile GLFW and the accompanying example programs, you will need **CMake**, +which will generate the project files or makefiles for your particular +development environment. If you are on a Unix-like system such as Linux or +FreeBSD or have a package system like Fink, MacPorts, Cygwin or Homebrew, you +can simply install its CMake package. If not, you can get installers for +Windows and OS X from the [CMake website](http://www.cmake.org/). + +Additional dependencies are listed below. + +If you wish to compile GLFW without CMake, see @ref compile_manual. + + +@subsection compile_deps_msvc Dependencies using Visual C++ on Windows + +The Microsoft Platform SDK that is installed along with Visual C++ contains all +the necessary headers, link libraries and tools except for CMake. + + +@subsection compile_deps_mingw Dependencies with MinGW or MinGW-w64 on Windows + +Both the MinGW and the MinGW-w64 packages contain all the necessary headers, +link libraries and tools except for CMake. + + +@subsection compile_deps_mingw_cross Dependencies using MinGW or MinGW-w64 cross-compilation + +Both Cygwin and many Linux distributions have MinGW or MinGW-w64 packages. For +example, Cygwin has the `mingw64-i686-gcc` and `mingw64-x86_64-gcc` packages +for 32- and 64-bit version of MinGW-w64, while Debian GNU/Linux and derivatives +like Ubuntu have the `mingw-w64` package for both. + +GLFW has CMake toolchain files in the `CMake/` directory that allow for easy +cross-compilation of Windows binaries. To use these files you need to add a +special parameter when generating the project files or makefiles: + + cmake -DCMAKE_TOOLCHAIN_FILE= . + +The exact toolchain file to use depends on the prefix used by the MinGW or +MinGW-w64 binaries on your system. You can usually see this in the /usr +directory. For example, both the Debian/Ubuntu and Cygwin MinGW-w64 packages +have `/usr/x86_64-w64-mingw32` for the 64-bit compilers, so the correct +invocation would be: + + cmake -DCMAKE_TOOLCHAIN_FILE=CMake/x86_64-w64-mingw32.cmake . + +For more details see the article +[CMake Cross Compiling](http://www.paraview.org/Wiki/CMake_Cross_Compiling) on +the CMake wiki. + + +@subsection compile_deps_xcode Dependencies using Xcode on OS X + +Xcode contains all necessary tools except for CMake. The necessary headers and +libraries are included in the core OS frameworks. Xcode can be downloaded from +the Mac App Store or from the ADC Member Center. + + +@subsection compile_deps_x11 Dependencies using Linux and X11 + +To compile GLFW for X11, you need to have the X11 and OpenGL header packages +installed, as well as the basic development tools like GCC and make. For +example, on Ubuntu and other distributions based on Debian GNU/Linux, you need +to install the `xorg-dev` and `libglu1-mesa-dev` packages. The former pulls in +all X.org header packages and the latter pulls in the Mesa OpenGL and GLU +packages. GLFW itself doesn't need or use GLU, but some of the examples do. +Note that using header files and libraries from Mesa during compilation *will +not* tie your binaries to the Mesa implementation of OpenGL. + + +@section compile_cmake Generating files with CMake + +Once you have all necessary dependencies it is time to generate the project +files or makefiles for your development environment. CMake needs to know two +paths for this: the path to the *root* directory of the GLFW source tree (i.e. +*not* the `src` subdirectory) and the target path for the generated files and +compiled binaries. If these are the same, it is called an in-tree build, +otherwise it is called an out-of-tree build. + +One of several advantages of out-of-tree builds is that you can generate files +and compile for different development environments using a single source tree. + + +@subsection compile_cmake_cli Generating files with the CMake command-line tool + +To make an in-tree build, enter the *root* directory of the GLFW source tree +(i.e. *not* the `src` subdirectory) and run CMake. The current directory is +used as target path, while the path provided as an argument is used to find the +source tree. + + cd + cmake . + +To make an out-of-tree build, make another directory, enter it and run CMake +with the (relative or absolute) path to the root of the source tree as an +argument. + + cd + mkdir build + cd build + cmake .. + + +@subsection compile_cmake_gui Generating files with the CMake GUI + +If you are using the GUI version, choose the root of the GLFW source tree as +source location and the same directory or another, empty directory as the +destination for binaries. Choose *Configure*, change any options you wish to, +*Configure* again to let the changes take effect and then *Generate*. + + +@section compile_options CMake options + +The CMake files for GLFW provide a number of options, although not all are +available on all supported platforms. Some of these are de facto standards +among CMake users and so have no `GLFW_` prefix. + +If you are using the GUI version of CMake, these are listed and can be changed +from there. If you are using the command-line version, use the `ccmake` tool. +Some package systems like Ubuntu and other distributions based on Debian +GNU/Linux have this tool in a separate `cmake-curses-gui` package. + + +@subsection compile_options_shared Shared CMake options + +`BUILD_SHARED_LIBS` determines whether GLFW is built as a static +library or as a DLL / shared library / dynamic library. + +`LIB_SUFFIX` affects where the GLFW shared /dynamic library is installed. If it +is empty, it is installed to `${CMAKE_INSTALL_PREFIX}/lib`. If it is set to +`64`, it is installed to `${CMAKE_INSTALL_PREFIX}/lib64`. + +`GLFW_CLIENT_LIBRARY` determines which client API library to use. If set to +`opengl` the OpenGL library is used, if set to `glesv1` for the OpenGL ES 1.x +library is used, or if set to `glesv2` the OpenGL ES 2.0 library is used. The +selected library and its header files must be present on the system for this to +work. + +`GLFW_BUILD_EXAMPLES` determines whether the GLFW examples are built +along with the library. + +`GLFW_BUILD_TESTS` determines whether the GLFW test programs are +built along with the library. + +`GLFW_BUILD_DOCS` determines whether the GLFW documentation is built along with +the library. + + +@subsection compile_options_osx OS X specific CMake options + +`GLFW_USE_CHDIR` determines whether `glfwInit` changes the current +directory of bundled applications to the `Contents/Resources` directory. + +`GLFW_USE_MENUBAR` determines whether the first call to +`glfwCreateWindow` sets up a minimal menu bar. + +`GLFW_BUILD_UNIVERSAL` determines whether to build Universal Binaries. + + +@subsection compile_options_win32 Windows specific CMake options + +`USE_MSVC_RUNTIME_LIBRARY_DLL` determines whether to use the DLL version or the +static library version of the Visual C++ runtime library. If set to `ON`, the +DLL version of the Visual C++ library is used. It is recommended to set this to +`ON`, as this keeps the executable smaller and benefits from security and bug +fix updates of the Visual C++ runtime. + +`GLFW_USE_DWM_SWAP_INTERVAL` determines whether the swap interval is set even +when DWM compositing is enabled. If this is `ON`, the swap interval is set even +if DWM is enabled. It is recommended to set this to `OFF`, as doing otherwise +can lead to severe jitter. + +`GLFW_USE_OPTIMUS_HPG` determines whether to export the `NvOptimusEnablement` +symbol, which forces the use of the high-performance GPU on nVidia Optimus +systems. + + +@subsection compile_options_egl EGL specific CMake options + +`GLFW_USE_EGL` determines whether to use EGL instead of the platform-specific +context creation API. Note that EGL is not yet provided on all supported +platforms. + + +@section compile_manual Compiling GLFW manually + +If you wish to compile GLFW without its CMake build environment then you will +have to do at least some of the platform detection yourself. GLFW needs +a number of configuration macros to be defined in order to know what it's being +compiled for and has many optional, platform-specific ones for various features. + +When building with CMake, the `glfw_config.h` configuration header is generated +based on the current platform and CMake options. The GLFW CMake environment +defines `_GLFW_USE_CONFIG_H`, which causes this header to be included by +`internal.h`. Without this macro, GLFW will expect the necessary configuration +macros to be defined on the command-line. + +Three macros *must* be defined when compiling GLFW: one for selecting the window +creation API, one selecting the context creation API and one client library. +Exactly one of each kind must be defined for GLFW to compile and link. + +The window creation API is used to create windows, handle input, monitors, gamma +ramps and clipboard. The options are: + + - `_GLFW_COCOA` to use the Cocoa frameworks + - `_GLFW_WIN32` to use the Win32 API + - `_GLFW_X11` to use the X Window System + +The context creation API is used to enumerate pixel formats / framebuffer +configurations and to create contexts. The options are: + + - `_GLFW_NSGL` to use the Cocoa OpenGL framework + - `_GLFW_WGL` to use the Win32 WGL API + - `_GLFW_GLX` to use the X11 GLX API + - `_GLFW_EGL` to use the EGL API (experimental) + +The client library is the one providing the OpenGL or OpenGL ES API, which is +used by GLFW to probe the created context. This is not the same thing as the +client API, as many desktop OpenGL client libraries now expose the OpenGL ES API +through extensions. The options are: + + - `_GLFW_USE_OPENGL` for the desktop OpenGL (opengl32.dll, libGL.so or + OpenGL.framework) + - `_GLFW_USE_GLESV1` for OpenGL ES 1.x (experimental) + - `_GLFW_USE_GLESV2` for OpenGL ES 2.x (experimental) + +Note that `_GLFW_USE_GLESV1` and `_GLFW_USE_GLESV2` may only be used with EGL, +as the other context creation APIs do not interface with OpenGL ES client +libraries. + +If you are building GLFW as a shared library / dynamic library / DLL then you +must also define `_GLFW_BUILD_DLL`. Otherwise, you may not define it. + +If you are using the X11 window creation API then you *must* also select an entry +point retrieval mechanism. + + - `_GLFW_HAS_GLXGETPROCADDRESS` to use `glXGetProcAddress` (recommended) + - `_GLFW_HAS_GLXGETPROCADDRESSARB` to use `glXGetProcAddressARB` (legacy) + - `_GLFW_HAS_GLXGETPROCADDRESSEXT` to use `glXGetProcAddressEXT` (legacy) + - `_GLFW_HAS_DLOPEN` to do manual retrieval with `dlopen` (fallback) + +If you are using the Cocoa window creation API, the following options are +available: + + - `_GLFW_USE_CHDIR` to `chdir` to the `Resources` subdirectory of the + application bundle during @ref glfwInit (recommended) + - `_GLFW_USE_MENUBAR` to create and populate the menu bar when the first window + is created (recommended) + +*/ diff --git a/extern/glfw/docs/context.dox b/extern/glfw/docs/context.dox index 56d1de7..8057cc7 100644 --- a/extern/glfw/docs/context.dox +++ b/extern/glfw/docs/context.dox @@ -24,6 +24,15 @@ what kind of context is created. See [context related hints](@ref window_hints_ctx) in the window handling guide. +@section context_sharing Context object sharing + +When creating a window and context with @ref glfwCreateWindow, you can specify +another window whose context the new one should share its objects with. OpenGL +object sharing is implemented by the operating system and graphics driver and is +described in the OpenGL documentation. On platforms where it is possible to +choose which types of objects are shared, GLFW requests that all are shared. + + @section context_current Current context Before you can use the OpenGL or OpenGL ES APIs, you need to have a current diff --git a/extern/glfw/docs/extra.css b/extern/glfw/docs/extra.css new file mode 100644 index 0000000..639c4e7 --- /dev/null +++ b/extern/glfw/docs/extra.css @@ -0,0 +1,312 @@ +html { + background-color:hsl(0,0%,95%); +} + +.glfwheader { + font-size:16px; + height:64px; + max-width:920px; + margin:0em auto; +} + +.glfwheader a#glfwhome { + line-height:64px; + padding-right:48px; + float:left; + color:hsl(0,0%,40%); + font-size:2.5em; + background-image:url("http://www.glfw.org/css/arrow.png"); + background-position:right top; + background-repeat:no-repeat; +} + +.glfwnavbar { + list-style-type:none; + margin-top:0px; + float:right; +} + +.glfwnavbar li { + float:left; +} + +.glfwnavbar a,.glfwnavbar a:visited { + line-height:64px; + margin-left:2em; + display:block; + color:hsl(0,0%,40%); +} + +.glfwheader a#glfwhome,.glfwnavbar a,.glfwnavbar a:visited { + transition:all 0.35s ease 0s; +} + +#titlearea,address.footer { + color:hsl(0,0%,40%); + background-color:hsl(0,0%,95%); + border-bottom:none; +} + +address.footer { + text-align:center; + padding:2em; +} + +div#top { + background-color:hsl(0,0%,40%); +} + +div#navrow1,div#navrow2,div#navrow3,div#navrow4 { + background-color:hsl(0,0%,40%); + background-image:none; + max-width:920px; + margin:0em auto; +} + +ul.tablist { + min-width:700px; +} + +.tablist a,.tablist a:hover,.tablist li,.tablist li.current a { + background-image:none; + text-shadow:none; +} + +.tablist a,.tablist a:visited { + color:hsl(0,0%,95%); + text-shadow:none; +} + +.tablist li.current a { + background:linear-gradient(to bottom,hsl(34,100%,60%) 0%,hsl(24,100%,50%) 100%); + box-shadow:inset 0px 0px 32px hsl(24,100%,50%); + text-shadow:0px -1px 1px hsl(24,100%,35%); + color:hsl(0,0%,100%); +} + +div.contents { + min-height:590px; +} + +div.contents,div.header { + max-width:920px; + margin:0em auto; + padding:0em 2em 2em 2em; + background-color:hsl(0,0%,100%); +} + +div.header { + background-image:none; + border-bottom:none; +} + +table.doxtable th,dl.reflist dt,div.levels { + background:linear-gradient(to bottom,hsl(34,100%,60%) 0%,hsl(24,100%,50%) 100%); + box-shadow:inset 0px 0px 32px hsl(24,100%,50%); + text-shadow:0px -1px 1px hsl(24,100%,35%); + color:hsl(0,0%,100%); +} + +dl.reflist dt a.el,div.levels span { + color:hsl(24,100%,50%); + padding:0.2em; + border-radius:4px; + background-color:hsl(24,100%,90%); + text-shadow:none; +} + +div.memproto,div.qindex,div.ah { + background:linear-gradient(to bottom,hsl(34,0%,95%) 0%,hsl(24,0%,90%) 100%); + box-shadow:inset 0px 0px 32px hsl(24,0%,90%); + text-shadow:0px 1px 1px hsl(24,0%,100%); + color:hsl(0,0%,10%); +} + +div.memproto a { + color:hsl(24,100%,50%); +} + +div.memproto td.paramname { + text-shadow:0px 1px 1px hsl(24,0%,100%); +} + +div.memproto,div.qindex,div.ah { + border:2px solid hsl(24,0%,90%); + border-radius:4px; +} + +div.memdoc { + background:none; + box-shadow:none; + border:none; +} + +td.paramname { + color:hsl(24,100%,25%); +} + +dl.reflist dt { + border:2px solid hsl(24,100%,50%); + border-top-left-radius:4px; + border-top-right-radius:4px; + border-bottom:none; +} + +dl.reflist dd { + border:2px solid hsl(24,100%,50%); + border-bottom-right-radius:4px; + border-bottom-left-radius:4px; + border-top:none; + background:none; + box-shadow:none; +} + +table.doxtable { + border-collapse:inherit; + border-spacing:0px; + border:2px solid hsl(24,100%,50%); + border-radius:4px; +} + +table.doxtable td,table.doxtable th { + border:none; +} + +tr.even,.directory tr.even,table.doxtable tr:nth-child(even) { + background-color:hsl(0,0%,95%); +} + +body { + color:hsl(0,0%,30%); +} + +h1,h2,h2.groupheader,h3,div.toc h3,h4,h5,h6,strong,em { + color:hsl(0,0%,10%); + border-bottom:none; +} + +a,a:hover,a:visited,a:visited:hover,a.el,a.el:visited,.glfwheader a#glfwhome:hover,.tablist a:hover { + color:hsl(24,100%,50%); + text-decoration:none; +} + +.mdescLeft,.mdescRight,.memItemLeft,.memItemRight { + background-color:hsl(0,0%,95%); +} + +div.directory { + border-collapse:inherit; + border-spacing:0px; + border:2px solid hsl(24,100%,50%); + border-radius:4px; +} + +.directory .levels span { + color:hsl(24,100%,50%); + padding:0.1em 0.5em; + margin:auto 0.25em; + border-radius:2px; + background-color:hsl(24,100%,90%); + text-shadow:none; +} + +td.memSeparator { + height:2px; + border:0px; + background:linear-gradient(to right,hsl(0,0%,95%) 0%,hsl(0,0%,85%) 50%,hsl(0,0%,95%) 100%); +} + +dl.note,dl.pre,dl.post,dl.invariant { + background:linear-gradient(to bottom,hsl(103,80%,90%) 0%,hsl(103,80%,85%) 100%); + box-shadow:inset 0px 0px 32px hsl(103,40%,80%); + color:hsl(103,80%,10%); + border:2px solid hsl(103,40%,75%); +} + +dl.warning,dl.attention { + background:linear-gradient(to bottom,hsl(34,80%,90%) 0%,hsl(34,80%,85%) 100%); + box-shadow:inset 0px 0px 32px hsl(34,40%,80%); + color:hsl(34,80%,10%); + border:2px solid hsl(34,40%,75%); +} + +dl.deprecated,dl.bug { + background:linear-gradient(to bottom,hsl(333,80%,90%) 0%,hsl(333,80%,85%) 100%); + box-shadow:inset 0px 0px 32px hsl(333,40%,80%); + color:hsl(333,80%,10%); + border:2px solid hsl(333,40%,75%); +} + +dl.todo,dl.test { + background:linear-gradient(to bottom,hsl(200,80%,90%) 0%,hsl(200,80%,85%) 100%); + box-shadow:inset 0px 0px 32px hsl(200,40%,80%); + color:hsl(200,80%,10%); + border:2px solid hsl(200,40%,75%); +} + +dl.note,dl.pre,dl.post,dl.invariant,dl.warning,dl.attention,dl.deprecated,dl.bug,dl.todo,dl.test { + border-radius:4px; + padding:1em; + text-shadow:0px 1px 1px hsl(0,0%,100%); +} + +div.toc { + background:linear-gradient(to bottom,hsl(34,0%,95%) 0%,hsl(24,0%,90%) 100%); + box-shadow:inset 0px 0px 32px hsl(24,0%,90%); + text-shadow:0px 1px 1px hsl(24,0%,100%); + color:hsl(0,0%,10%); + border:2px solid hsl(24,0%,90%); + border-radius:4px; + float:none; + width:auto; +} + +div.toc h3 { + font-size:1.17em; +} + +div.toc ul { + padding-left:1.5em; +} + +div.toc li { + background:none; + font-size:1em; + padding-left:0em; + list-style-type:disc; +} + +div.ah { + background-image:none; +} + +div.fragment,pre.fragment { + background-color:hsl(0,0%,20%); + border-radius:4px; + border-width:0px; + padding:0.5em 2em; + overflow:auto; + border-left:4px solid hsl(0,0%,80%); +} + +div.line,pre.fragment { + color:hsl(60,30%,96%); +} + +a.code,a.code:visited,span.preprocessor,span.comment { + color:hsl(80,76%,53%); +} + +span.keyword,span.keywordtype,span.keywordflow { + color:hsl(190,81%,67%); +} + +span.stringliteral { + color:hsl(54,70%,68%); +} + +code { + background-color:hsl(0,0%,95%); + padding:0.1em; + border-radius: 4px; +} diff --git a/extern/glfw/docs/footer.html b/extern/glfw/docs/footer.html new file mode 100644 index 0000000..b0434ca --- /dev/null +++ b/extern/glfw/docs/footer.html @@ -0,0 +1,7 @@ + + + diff --git a/extern/glfw/docs/header.html b/extern/glfw/docs/header.html new file mode 100644 index 0000000..9759d8b --- /dev/null +++ b/extern/glfw/docs/header.html @@ -0,0 +1,34 @@ + + + + + + +$projectname: $title +$title + + + +$treeview +$search +$mathjax + +$extrastylesheet + + +
+ + + + + diff --git a/extern/glfw/docs/internal.dox b/extern/glfw/docs/internal.dox index e32db62..a2653fe 100644 --- a/extern/glfw/docs/internal.dox +++ b/extern/glfw/docs/internal.dox @@ -105,8 +105,8 @@ Examples: `clearScrollOffsets` @section internals_config Configuration macros GLFW uses a number of configuration macros to select at compile time which -interfaces and code paths to use. They are defined in the config.h header file, -which is generated from the `config.h.in` file by CMake. +interfaces and code paths to use. They are defined in the glfw_config.h header file, +which is generated from the `glfw_config.h.in` file by CMake. Configuration macros the same style as tokens in the public interface, except with a leading underscore. diff --git a/extern/glfw/docs/main.dox b/extern/glfw/docs/main.dox index fac4b4d..1898079 100644 --- a/extern/glfw/docs/main.dox +++ b/extern/glfw/docs/main.dox @@ -11,7 +11,9 @@ existing applications and does not lay claim to the main loop. This is the documentation for version 3.0, which has [many new features](@ref news). There is a [quick tutorial](@ref quick) for people new to GLFW, which shows how -to write a small but complete program. +to write a small but complete program, and guides for +[compiling GLFW](@ref compile) and +[building programs that use GLFW](@ref build). If you have used GLFW 2.x in the past, there is a [transition guide](@ref moving) that explains what has changed and how to update diff --git a/extern/glfw/docs/moving.dox b/extern/glfw/docs/moving.dox index 4ca9d6c..8d5c2e8 100644 --- a/extern/glfw/docs/moving.dox +++ b/extern/glfw/docs/moving.dox @@ -176,13 +176,24 @@ similar to that of GLFW 2. @subsection moving_window_close Window closing -Window closing is now just an event like any other. GLFW 3 windows won't -disappear from underfoot even when no close callback is set; instead the -window's close flag is set. You can query this flag using @ref -glfwWindowShouldClose, or capture close events by setting a close callback. The -close flag can be modified from any point in your program using @ref +Window closing initiated by the user is now just an event like any other. +Unlike GLFW 2, windows and contexts created with GLFW 3 will not disappear from +underfoot. Each window now has a close flag, which is set when the user +attempts to close it. By default, nothing else happens and the window stays +open and visible. It is then up to you to either destroy the window, take some +other action or simply ignore the request. You can query the close flag at any +time with @ref glfwWindowShouldClose and set it at any time with @ref glfwSetWindowShouldClose. +The close callback no longer returns a value. Instead, it is called after the +close flag has been set so it can override its value, if it chooses to, before +event processing completes. You may however not call @ref glfwDestroyWindow +from the close callback (or any other window related callback). + +GLFW itself never clears the close flag, allowing you to set it for other +reasons for the window to close as well, for example the user choosing Quit from +the main menu. + @subsection moving_context Explicit context management diff --git a/extern/glfw/docs/news.dox b/extern/glfw/docs/news.dox index 6f97afc..bbce25f 100644 --- a/extern/glfw/docs/news.dox +++ b/extern/glfw/docs/news.dox @@ -18,7 +18,7 @@ For more information on how to use CMake, see the [CMake manual](http://cmake.org/cmake/help/documentation.html). -@subsection new_30_multiwnd Multi-window support +@subsection news_30_multiwnd Multi-window support GLFW now supports the creation of multiple windows, each with their own OpenGL or OpenGL ES context, and all window functions now take a window handle. Event @@ -79,7 +79,7 @@ through CMake options. GLFW now supports high-DPI monitors on both Windows and OS X, giving windows full resolution framebuffers where other UI elements are scaled up. To achieve this, @ref glfwGetFramebufferSize and @ref glfwSetFramebufferSizeCallback have been -added. These work with pixels, while the rest of the GLFW API work with screen +added. These work with pixels, while the rest of the GLFW API works with screen coordinates. diff --git a/extern/glfw/docs/quick.dox b/extern/glfw/docs/quick.dox index aa32ff3..d024730 100644 --- a/extern/glfw/docs/quick.dox +++ b/extern/glfw/docs/quick.dox @@ -302,4 +302,7 @@ the screen, rendering a triangle and processing events until the user closes the window. It can be found in the source distribution as `examples/simple.c`, and is by default compiled along with all other examples when you build GLFW. +To learn more about how to compile and link programs that use GLFW, see +@ref build. + */ diff --git a/extern/glfw/docs/window.dox b/extern/glfw/docs/window.dox index c91a67d..ab83e50 100644 --- a/extern/glfw/docs/window.dox +++ b/extern/glfw/docs/window.dox @@ -62,6 +62,14 @@ Once this function is called, no more events will be delivered for that window and its handle becomes invalid. +@section window_userptr Window user pointer + +Each window has a user pointer that can be set with @ref +glfwSetWindowUserPointer and fetched with @ref glfwGetWindowUserPointer. This +can be used for any purpose you need and will not modified by GLFW throughout +the life-time of the window. + + @section window_hints Window creation hints There are a number of hints that can be set before the creation of a window and @@ -440,7 +448,9 @@ context is an OpenGL debug context, or `GL_FALSE` otherwise. The `GLFW_OPENGL_PROFILE` attribute indicates the OpenGL profile used by the context. This is `GLFW_OPENGL_CORE_PROFILE` or `GLFW_OPENGL_COMPAT_PROFILE` if the context uses a known profile, or `GLFW_OPENGL_ANY_PROFILE` if the -OpenGL profile is unknown or the context is for another client API. +OpenGL profile is unknown or the context is for another client API. Note that +the returned profile may not match the profile bits of the context flags, as +GLFW will try other means of detecting the profile when no bits are set. The `GLFW_CONTEXT_ROBUSTNESS` attribute indicates the robustness strategy used by the context. This is `GLFW_LOSE_CONTEXT_ON_RESET` or @@ -477,8 +487,10 @@ zero can be useful for benchmarking purposes, when it is not desirable to measure the time it takes to wait for the vertical retrace. However, a swap interval of one lets you avoid tearing. -Note that not all OpenGL implementations properly implement this function, in -which case @ref glfwSwapInterval will have no effect. Some drivers also have -user settings that override requests by GLFW. +Note that this may not work on all machines, as some drivers have +user-controlled settings that override any swap interval the application +requests. It is also by default disabled on Windows Vista and later when using +DWM (Aero), as using it there sometimes leads to severe jitter. You can +forcibly enable it for machines using DWM using @ref compile_options_win32. */ diff --git a/extern/glfw/examples/CMakeLists.txt b/extern/glfw/examples/CMakeLists.txt new file mode 100644 index 0000000..0199819 --- /dev/null +++ b/extern/glfw/examples/CMakeLists.txt @@ -0,0 +1,60 @@ + +link_libraries(glfw ${OPENGL_glu_LIBRARY}) + +if (BUILD_SHARED_LIBS) + add_definitions(-DGLFW_DLL) + link_libraries(${OPENGL_gl_LIBRARY} ${MATH_LIBRARY}) +else() + link_libraries(${glfw_LIBRARIES}) +endif() + +include_directories(${GLFW_SOURCE_DIR}/include + ${GLFW_SOURCE_DIR}/deps) + +if (NOT APPLE) + # HACK: This is NOTFOUND on OS X 10.8 + include_directories(${OPENGL_INCLUDE_DIR}) +endif() + +set(GETOPT ${GLFW_SOURCE_DIR}/deps/getopt.h + ${GLFW_SOURCE_DIR}/deps/getopt.c) + +if (APPLE) + # Set fancy names for bundles + add_executable(Boing MACOSX_BUNDLE boing.c) + add_executable(Gears MACOSX_BUNDLE gears.c) + add_executable(Simple MACOSX_BUNDLE simple.c) + add_executable("Split View" MACOSX_BUNDLE splitview.c) + add_executable(Wave MACOSX_BUNDLE wave.c) + + set_target_properties(Boing PROPERTIES MACOSX_BUNDLE_BUNDLE_NAME "Boing") + set_target_properties(Gears PROPERTIES MACOSX_BUNDLE_BUNDLE_NAME "Gears") + set_target_properties(Simple PROPERTIES MACOSX_BUNDLE_BUNDLE_NAME "Simple") + set_target_properties("Split View" PROPERTIES MACOSX_BUNDLE_BUNDLE_NAME "Split View") + set_target_properties(Wave PROPERTIES MACOSX_BUNDLE_BUNDLE_NAME "Wave") +else() + # Set boring names for executables + add_executable(boing WIN32 boing.c) + add_executable(gears WIN32 gears.c) + add_executable(heightmap WIN32 heightmap.c ${GETOPT}) + add_executable(simple WIN32 simple.c) + add_executable(splitview WIN32 splitview.c) + add_executable(wave WIN32 wave.c) +endif() + +if (MSVC) + set(WINDOWS_BINARIES boing gears heightmap simple splitview wave) + + # Tell MSVC to use main instead of WinMain for Windows subsystem executables + set_target_properties(${WINDOWS_BINARIES} PROPERTIES + LINK_FLAGS "/ENTRY:mainCRTStartup") +endif() + +if (APPLE) + set(BUNDLE_BINARIES Boing Gears Simple "Split View" Wave) + + set_target_properties(${BUNDLE_BINARIES} PROPERTIES + MACOSX_BUNDLE_SHORT_VERSION_STRING ${GLFW_VERSION} + MACOSX_BUNDLE_LONG_VERSION_STRING ${GLFW_VERSION_FULL}) +endif() + diff --git a/extern/glfw/examples/boing.c b/extern/glfw/examples/boing.c new file mode 100644 index 0000000..79d2e95 --- /dev/null +++ b/extern/glfw/examples/boing.c @@ -0,0 +1,628 @@ +/***************************************************************************** + * Title: GLBoing + * Desc: Tribute to Amiga Boing. + * Author: Jim Brooks + * Original Amiga authors were R.J. Mical and Dale Luck. + * GLFW conversion by Marcus Geelnard + * Notes: - 360' = 2*PI [radian] + * + * - Distances between objects are created by doing a relative + * Z translations. + * + * - Although OpenGL enticingly supports alpha-blending, + * the shadow of the original Boing didn't affect the color + * of the grid. + * + * - [Marcus] Changed timing scheme from interval driven to frame- + * time based animation steps (which results in much smoother + * movement) + * + * History of Amiga Boing: + * + * Boing was demonstrated on the prototype Amiga (codenamed "Lorraine") in + * 1985. According to legend, it was written ad-hoc in one night by + * R. J. Mical and Dale Luck. Because the bouncing ball animation was so fast + * and smooth, attendees did not believe the Amiga prototype was really doing + * the rendering. Suspecting a trick, they began looking around the booth for + * a hidden computer or VCR. + *****************************************************************************/ + +#include +#include +#include + +#define GLFW_INCLUDE_GLU +#include + + +/***************************************************************************** + * Various declarations and macros + *****************************************************************************/ + +/* Prototypes */ +void init( void ); +void display( void ); +void reshape( GLFWwindow* window, int w, int h ); +void key_callback( GLFWwindow* window, int key, int scancode, int action, int mods ); +void DrawBoingBall( void ); +void BounceBall( double dt ); +void DrawBoingBallBand( GLfloat long_lo, GLfloat long_hi ); +void DrawGrid( void ); + +#define RADIUS 70.f +#define STEP_LONGITUDE 22.5f /* 22.5 makes 8 bands like original Boing */ +#define STEP_LATITUDE 22.5f + +#define DIST_BALL (RADIUS * 2.f + RADIUS * 0.1f) + +#define VIEW_SCENE_DIST (DIST_BALL * 3.f + 200.f)/* distance from viewer to middle of boing area */ +#define GRID_SIZE (RADIUS * 4.5f) /* length (width) of grid */ +#define BOUNCE_HEIGHT (RADIUS * 2.1f) +#define BOUNCE_WIDTH (RADIUS * 2.1f) + +#define SHADOW_OFFSET_X -20.f +#define SHADOW_OFFSET_Y 10.f +#define SHADOW_OFFSET_Z 0.f + +#define WALL_L_OFFSET 0.f +#define WALL_R_OFFSET 5.f + +/* Animation speed (50.0 mimics the original GLUT demo speed) */ +#define ANIMATION_SPEED 50.f + +/* Maximum allowed delta time per physics iteration */ +#define MAX_DELTA_T 0.02f + +/* Draw ball, or its shadow */ +typedef enum { DRAW_BALL, DRAW_BALL_SHADOW } DRAW_BALL_ENUM; + +/* Vertex type */ +typedef struct {float x; float y; float z;} vertex_t; + +/* Global vars */ +GLfloat deg_rot_y = 0.f; +GLfloat deg_rot_y_inc = 2.f; +GLfloat ball_x = -RADIUS; +GLfloat ball_y = -RADIUS; +GLfloat ball_x_inc = 1.f; +GLfloat ball_y_inc = 2.f; +DRAW_BALL_ENUM drawBallHow; +double t; +double t_old = 0.f; +double dt; + +/* Random number generator */ +#ifndef RAND_MAX + #define RAND_MAX 4095 +#endif + +/* PI */ +#ifndef M_PI + #define M_PI 3.1415926535897932384626433832795 +#endif + + +/***************************************************************************** + * Truncate a degree. + *****************************************************************************/ +GLfloat TruncateDeg( GLfloat deg ) +{ + if ( deg >= 360.f ) + return (deg - 360.f); + else + return deg; +} + +/***************************************************************************** + * Convert a degree (360-based) into a radian. + * 360' = 2 * PI + *****************************************************************************/ +double deg2rad( double deg ) +{ + return deg / 360 * (2 * M_PI); +} + +/***************************************************************************** + * 360' sin(). + *****************************************************************************/ +double sin_deg( double deg ) +{ + return sin( deg2rad( deg ) ); +} + +/***************************************************************************** + * 360' cos(). + *****************************************************************************/ +double cos_deg( double deg ) +{ + return cos( deg2rad( deg ) ); +} + +/***************************************************************************** + * Compute a cross product (for a normal vector). + * + * c = a x b + *****************************************************************************/ +void CrossProduct( vertex_t a, vertex_t b, vertex_t c, vertex_t *n ) +{ + GLfloat u1, u2, u3; + GLfloat v1, v2, v3; + + u1 = b.x - a.x; + u2 = b.y - a.y; + u3 = b.y - a.z; + + v1 = c.x - a.x; + v2 = c.y - a.y; + v3 = c.z - a.z; + + n->x = u2 * v3 - v2 * v3; + n->y = u3 * v1 - v3 * u1; + n->z = u1 * v2 - v1 * u2; +} + +/***************************************************************************** + * Calculate the angle to be passed to gluPerspective() so that a scene + * is visible. This function originates from the OpenGL Red Book. + * + * Parms : size + * The size of the segment when the angle is intersected at "dist" + * (ie at the outermost edge of the angle of vision). + * + * dist + * Distance from viewpoint to scene. + *****************************************************************************/ +GLfloat PerspectiveAngle( GLfloat size, + GLfloat dist ) +{ + GLfloat radTheta, degTheta; + + radTheta = 2.f * (GLfloat) atan2( size / 2.f, dist ); + degTheta = (180.f * radTheta) / (GLfloat) M_PI; + return degTheta; +} + + + +#define BOING_DEBUG 0 + + +/***************************************************************************** + * init() + *****************************************************************************/ +void init( void ) +{ + /* + * Clear background. + */ + glClearColor( 0.55f, 0.55f, 0.55f, 0.f ); + + glShadeModel( GL_FLAT ); +} + + +/***************************************************************************** + * display() + *****************************************************************************/ +void display(void) +{ + glClear( GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT ); + glPushMatrix(); + + drawBallHow = DRAW_BALL_SHADOW; + DrawBoingBall(); + + DrawGrid(); + + drawBallHow = DRAW_BALL; + DrawBoingBall(); + + glPopMatrix(); + glFlush(); +} + + +/***************************************************************************** + * reshape() + *****************************************************************************/ +void reshape( GLFWwindow* window, int w, int h ) +{ + glViewport( 0, 0, (GLsizei)w, (GLsizei)h ); + + glMatrixMode( GL_PROJECTION ); + glLoadIdentity(); + + gluPerspective( PerspectiveAngle( RADIUS * 2, 200 ), + (GLfloat)w / (GLfloat)h, + 1.0, + VIEW_SCENE_DIST ); + + glMatrixMode( GL_MODELVIEW ); + glLoadIdentity(); + + gluLookAt( 0.0, 0.0, VIEW_SCENE_DIST,/* eye */ + 0.0, 0.0, 0.0, /* center of vision */ + 0.0, -1.0, 0.0 ); /* up vector */ +} + +void key_callback( GLFWwindow* window, int key, int scancode, int action, int mods ) +{ + if (key == GLFW_KEY_ESCAPE && action == GLFW_PRESS) + glfwSetWindowShouldClose(window, GL_TRUE); +} + +/***************************************************************************** + * Draw the Boing ball. + * + * The Boing ball is sphere in which each facet is a rectangle. + * Facet colors alternate between red and white. + * The ball is built by stacking latitudinal circles. Each circle is composed + * of a widely-separated set of points, so that each facet is noticably large. + *****************************************************************************/ +void DrawBoingBall( void ) +{ + GLfloat lon_deg; /* degree of longitude */ + double dt_total, dt2; + + glPushMatrix(); + glMatrixMode( GL_MODELVIEW ); + + /* + * Another relative Z translation to separate objects. + */ + glTranslatef( 0.0, 0.0, DIST_BALL ); + + /* Update ball position and rotation (iterate if necessary) */ + dt_total = dt; + while( dt_total > 0.0 ) + { + dt2 = dt_total > MAX_DELTA_T ? MAX_DELTA_T : dt_total; + dt_total -= dt2; + BounceBall( dt2 ); + deg_rot_y = TruncateDeg( deg_rot_y + deg_rot_y_inc*((float)dt2*ANIMATION_SPEED) ); + } + + /* Set ball position */ + glTranslatef( ball_x, ball_y, 0.0 ); + + /* + * Offset the shadow. + */ + if ( drawBallHow == DRAW_BALL_SHADOW ) + { + glTranslatef( SHADOW_OFFSET_X, + SHADOW_OFFSET_Y, + SHADOW_OFFSET_Z ); + } + + /* + * Tilt the ball. + */ + glRotatef( -20.0, 0.0, 0.0, 1.0 ); + + /* + * Continually rotate ball around Y axis. + */ + glRotatef( deg_rot_y, 0.0, 1.0, 0.0 ); + + /* + * Set OpenGL state for Boing ball. + */ + glCullFace( GL_FRONT ); + glEnable( GL_CULL_FACE ); + glEnable( GL_NORMALIZE ); + + /* + * Build a faceted latitude slice of the Boing ball, + * stepping same-sized vertical bands of the sphere. + */ + for ( lon_deg = 0; + lon_deg < 180; + lon_deg += STEP_LONGITUDE ) + { + /* + * Draw a latitude circle at this longitude. + */ + DrawBoingBallBand( lon_deg, + lon_deg + STEP_LONGITUDE ); + } + + glPopMatrix(); + + return; +} + + +/***************************************************************************** + * Bounce the ball. + *****************************************************************************/ +void BounceBall( double delta_t ) +{ + GLfloat sign; + GLfloat deg; + + /* Bounce on walls */ + if ( ball_x > (BOUNCE_WIDTH/2 + WALL_R_OFFSET ) ) + { + ball_x_inc = -0.5f - 0.75f * (GLfloat)rand() / (GLfloat)RAND_MAX; + deg_rot_y_inc = -deg_rot_y_inc; + } + if ( ball_x < -(BOUNCE_HEIGHT/2 + WALL_L_OFFSET) ) + { + ball_x_inc = 0.5f + 0.75f * (GLfloat)rand() / (GLfloat)RAND_MAX; + deg_rot_y_inc = -deg_rot_y_inc; + } + + /* Bounce on floor / roof */ + if ( ball_y > BOUNCE_HEIGHT/2 ) + { + ball_y_inc = -0.75f - 1.f * (GLfloat)rand() / (GLfloat)RAND_MAX; + } + if ( ball_y < -BOUNCE_HEIGHT/2*0.85 ) + { + ball_y_inc = 0.75f + 1.f * (GLfloat)rand() / (GLfloat)RAND_MAX; + } + + /* Update ball position */ + ball_x += ball_x_inc * ((float)delta_t*ANIMATION_SPEED); + ball_y += ball_y_inc * ((float)delta_t*ANIMATION_SPEED); + + /* + * Simulate the effects of gravity on Y movement. + */ + if ( ball_y_inc < 0 ) sign = -1.0; else sign = 1.0; + + deg = (ball_y + BOUNCE_HEIGHT/2) * 90 / BOUNCE_HEIGHT; + if ( deg > 80 ) deg = 80; + if ( deg < 10 ) deg = 10; + + ball_y_inc = sign * 4.f * (float) sin_deg( deg ); +} + + +/***************************************************************************** + * Draw a faceted latitude band of the Boing ball. + * + * Parms: long_lo, long_hi + * Low and high longitudes of slice, resp. + *****************************************************************************/ +void DrawBoingBallBand( GLfloat long_lo, + GLfloat long_hi ) +{ + vertex_t vert_ne; /* "ne" means south-east, so on */ + vertex_t vert_nw; + vertex_t vert_sw; + vertex_t vert_se; + vertex_t vert_norm; + GLfloat lat_deg; + static int colorToggle = 0; + + /* + * Iterate thru the points of a latitude circle. + * A latitude circle is a 2D set of X,Z points. + */ + for ( lat_deg = 0; + lat_deg <= (360 - STEP_LATITUDE); + lat_deg += STEP_LATITUDE ) + { + /* + * Color this polygon with red or white. + */ + if ( colorToggle ) + glColor3f( 0.8f, 0.1f, 0.1f ); + else + glColor3f( 0.95f, 0.95f, 0.95f ); +#if 0 + if ( lat_deg >= 180 ) + if ( colorToggle ) + glColor3f( 0.1f, 0.8f, 0.1f ); + else + glColor3f( 0.5f, 0.5f, 0.95f ); +#endif + colorToggle = ! colorToggle; + + /* + * Change color if drawing shadow. + */ + if ( drawBallHow == DRAW_BALL_SHADOW ) + glColor3f( 0.35f, 0.35f, 0.35f ); + + /* + * Assign each Y. + */ + vert_ne.y = vert_nw.y = (float) cos_deg(long_hi) * RADIUS; + vert_sw.y = vert_se.y = (float) cos_deg(long_lo) * RADIUS; + + /* + * Assign each X,Z with sin,cos values scaled by latitude radius indexed by longitude. + * Eg, long=0 and long=180 are at the poles, so zero scale is sin(longitude), + * while long=90 (sin(90)=1) is at equator. + */ + vert_ne.x = (float) cos_deg( lat_deg ) * (RADIUS * (float) sin_deg( long_lo + STEP_LONGITUDE )); + vert_se.x = (float) cos_deg( lat_deg ) * (RADIUS * (float) sin_deg( long_lo )); + vert_nw.x = (float) cos_deg( lat_deg + STEP_LATITUDE ) * (RADIUS * (float) sin_deg( long_lo + STEP_LONGITUDE )); + vert_sw.x = (float) cos_deg( lat_deg + STEP_LATITUDE ) * (RADIUS * (float) sin_deg( long_lo )); + + vert_ne.z = (float) sin_deg( lat_deg ) * (RADIUS * (float) sin_deg( long_lo + STEP_LONGITUDE )); + vert_se.z = (float) sin_deg( lat_deg ) * (RADIUS * (float) sin_deg( long_lo )); + vert_nw.z = (float) sin_deg( lat_deg + STEP_LATITUDE ) * (RADIUS * (float) sin_deg( long_lo + STEP_LONGITUDE )); + vert_sw.z = (float) sin_deg( lat_deg + STEP_LATITUDE ) * (RADIUS * (float) sin_deg( long_lo )); + + /* + * Draw the facet. + */ + glBegin( GL_POLYGON ); + + CrossProduct( vert_ne, vert_nw, vert_sw, &vert_norm ); + glNormal3f( vert_norm.x, vert_norm.y, vert_norm.z ); + + glVertex3f( vert_ne.x, vert_ne.y, vert_ne.z ); + glVertex3f( vert_nw.x, vert_nw.y, vert_nw.z ); + glVertex3f( vert_sw.x, vert_sw.y, vert_sw.z ); + glVertex3f( vert_se.x, vert_se.y, vert_se.z ); + + glEnd(); + +#if BOING_DEBUG + printf( "----------------------------------------------------------- \n" ); + printf( "lat = %f long_lo = %f long_hi = %f \n", lat_deg, long_lo, long_hi ); + printf( "vert_ne x = %.8f y = %.8f z = %.8f \n", vert_ne.x, vert_ne.y, vert_ne.z ); + printf( "vert_nw x = %.8f y = %.8f z = %.8f \n", vert_nw.x, vert_nw.y, vert_nw.z ); + printf( "vert_se x = %.8f y = %.8f z = %.8f \n", vert_se.x, vert_se.y, vert_se.z ); + printf( "vert_sw x = %.8f y = %.8f z = %.8f \n", vert_sw.x, vert_sw.y, vert_sw.z ); +#endif + + } + + /* + * Toggle color so that next band will opposite red/white colors than this one. + */ + colorToggle = ! colorToggle; + + /* + * This circular band is done. + */ + return; +} + + +/***************************************************************************** + * Draw the purple grid of lines, behind the Boing ball. + * When the Workbench is dropped to the bottom, Boing shows 12 rows. + *****************************************************************************/ +void DrawGrid( void ) +{ + int row, col; + const int rowTotal = 12; /* must be divisible by 2 */ + const int colTotal = rowTotal; /* must be same as rowTotal */ + const GLfloat widthLine = 2.0; /* should be divisible by 2 */ + const GLfloat sizeCell = GRID_SIZE / rowTotal; + const GLfloat z_offset = -40.0; + GLfloat xl, xr; + GLfloat yt, yb; + + glPushMatrix(); + glDisable( GL_CULL_FACE ); + + /* + * Another relative Z translation to separate objects. + */ + glTranslatef( 0.0, 0.0, DIST_BALL ); + + /* + * Draw vertical lines (as skinny 3D rectangles). + */ + for ( col = 0; col <= colTotal; col++ ) + { + /* + * Compute co-ords of line. + */ + xl = -GRID_SIZE / 2 + col * sizeCell; + xr = xl + widthLine; + + yt = GRID_SIZE / 2; + yb = -GRID_SIZE / 2 - widthLine; + + glBegin( GL_POLYGON ); + + glColor3f( 0.6f, 0.1f, 0.6f ); /* purple */ + + glVertex3f( xr, yt, z_offset ); /* NE */ + glVertex3f( xl, yt, z_offset ); /* NW */ + glVertex3f( xl, yb, z_offset ); /* SW */ + glVertex3f( xr, yb, z_offset ); /* SE */ + + glEnd(); + } + + /* + * Draw horizontal lines (as skinny 3D rectangles). + */ + for ( row = 0; row <= rowTotal; row++ ) + { + /* + * Compute co-ords of line. + */ + yt = GRID_SIZE / 2 - row * sizeCell; + yb = yt - widthLine; + + xl = -GRID_SIZE / 2; + xr = GRID_SIZE / 2 + widthLine; + + glBegin( GL_POLYGON ); + + glColor3f( 0.6f, 0.1f, 0.6f ); /* purple */ + + glVertex3f( xr, yt, z_offset ); /* NE */ + glVertex3f( xl, yt, z_offset ); /* NW */ + glVertex3f( xl, yb, z_offset ); /* SW */ + glVertex3f( xr, yb, z_offset ); /* SE */ + + glEnd(); + } + + glPopMatrix(); + + return; +} + + +/*======================================================================* + * main() + *======================================================================*/ + +int main( void ) +{ + GLFWwindow* window; + int width, height; + + /* Init GLFW */ + if( !glfwInit() ) + exit( EXIT_FAILURE ); + + glfwWindowHint(GLFW_DEPTH_BITS, 16); + + window = glfwCreateWindow( 400, 400, "Boing (classic Amiga demo)", NULL, NULL ); + if (!window) + { + glfwTerminate(); + exit( EXIT_FAILURE ); + } + + glfwSetFramebufferSizeCallback(window, reshape); + glfwSetKeyCallback(window, key_callback); + + glfwMakeContextCurrent(window); + glfwSwapInterval( 1 ); + + glfwGetFramebufferSize(window, &width, &height); + reshape(window, width, height); + + glfwSetTime( 0.0 ); + + init(); + + /* Main loop */ + for (;;) + { + /* Timing */ + t = glfwGetTime(); + dt = t - t_old; + t_old = t; + + /* Draw one frame */ + display(); + + /* Swap buffers */ + glfwSwapBuffers(window); + glfwPollEvents(); + + /* Check if we are still running */ + if (glfwWindowShouldClose(window)) + break; + } + + glfwTerminate(); + exit( EXIT_SUCCESS ); +} + diff --git a/extern/glfw/examples/gears.c b/extern/glfw/examples/gears.c new file mode 100644 index 0000000..2d44596 --- /dev/null +++ b/extern/glfw/examples/gears.c @@ -0,0 +1,372 @@ +/* + * 3-D gear wheels. This program is in the public domain. + * + * Command line options: + * -info print GL implementation information + * -exit automatically exit after 30 seconds + * + * + * Brian Paul + * + * + * Marcus Geelnard: + * - Conversion to GLFW + * - Time based rendering (frame rate independent) + * - Slightly modified camera that should work better for stereo viewing + * + * + * Camilla Berglund: + * - Removed FPS counter (this is not a benchmark) + * - Added a few comments + * - Enabled vsync + */ + + +#include +#include +#include +#include +#include + +#ifndef M_PI +#define M_PI 3.141592654 +#endif + +/* If non-zero, the program exits after that many seconds + */ +static int autoexit = 0; + +/** + + Draw a gear wheel. You'll probably want to call this function when + building a display list since we do a lot of trig here. + + Input: inner_radius - radius of hole at center + outer_radius - radius at center of teeth + width - width of gear teeth - number of teeth + tooth_depth - depth of tooth + + **/ + +static void +gear(GLfloat inner_radius, GLfloat outer_radius, GLfloat width, + GLint teeth, GLfloat tooth_depth) +{ + GLint i; + GLfloat r0, r1, r2; + GLfloat angle, da; + GLfloat u, v, len; + + r0 = inner_radius; + r1 = outer_radius - tooth_depth / 2.f; + r2 = outer_radius + tooth_depth / 2.f; + + da = 2.f * (float) M_PI / teeth / 4.f; + + glShadeModel(GL_FLAT); + + glNormal3f(0.f, 0.f, 1.f); + + /* draw front face */ + glBegin(GL_QUAD_STRIP); + for (i = 0; i <= teeth; i++) { + angle = i * 2.f * (float) M_PI / teeth; + glVertex3f(r0 * (float) cos(angle), r0 * (float) sin(angle), width * 0.5f); + glVertex3f(r1 * (float) cos(angle), r1 * (float) sin(angle), width * 0.5f); + if (i < teeth) { + glVertex3f(r0 * (float) cos(angle), r0 * (float) sin(angle), width * 0.5f); + glVertex3f(r1 * (float) cos(angle + 3 * da), r1 * (float) sin(angle + 3 * da), width * 0.5f); + } + } + glEnd(); + + /* draw front sides of teeth */ + glBegin(GL_QUADS); + da = 2.f * (float) M_PI / teeth / 4.f; + for (i = 0; i < teeth; i++) { + angle = i * 2.f * (float) M_PI / teeth; + + glVertex3f(r1 * (float) cos(angle), r1 * (float) sin(angle), width * 0.5f); + glVertex3f(r2 * (float) cos(angle + da), r2 * (float) sin(angle + da), width * 0.5f); + glVertex3f(r2 * (float) cos(angle + 2 * da), r2 * (float) sin(angle + 2 * da), width * 0.5f); + glVertex3f(r1 * (float) cos(angle + 3 * da), r1 * (float) sin(angle + 3 * da), width * 0.5f); + } + glEnd(); + + glNormal3f(0.0, 0.0, -1.0); + + /* draw back face */ + glBegin(GL_QUAD_STRIP); + for (i = 0; i <= teeth; i++) { + angle = i * 2.f * (float) M_PI / teeth; + glVertex3f(r1 * (float) cos(angle), r1 * (float) sin(angle), -width * 0.5f); + glVertex3f(r0 * (float) cos(angle), r0 * (float) sin(angle), -width * 0.5f); + if (i < teeth) { + glVertex3f(r1 * (float) cos(angle + 3 * da), r1 * (float) sin(angle + 3 * da), -width * 0.5f); + glVertex3f(r0 * (float) cos(angle), r0 * (float) sin(angle), -width * 0.5f); + } + } + glEnd(); + + /* draw back sides of teeth */ + glBegin(GL_QUADS); + da = 2.f * (float) M_PI / teeth / 4.f; + for (i = 0; i < teeth; i++) { + angle = i * 2.f * (float) M_PI / teeth; + + glVertex3f(r1 * (float) cos(angle + 3 * da), r1 * (float) sin(angle + 3 * da), -width * 0.5f); + glVertex3f(r2 * (float) cos(angle + 2 * da), r2 * (float) sin(angle + 2 * da), -width * 0.5f); + glVertex3f(r2 * (float) cos(angle + da), r2 * (float) sin(angle + da), -width * 0.5f); + glVertex3f(r1 * (float) cos(angle), r1 * (float) sin(angle), -width * 0.5f); + } + glEnd(); + + /* draw outward faces of teeth */ + glBegin(GL_QUAD_STRIP); + for (i = 0; i < teeth; i++) { + angle = i * 2.f * (float) M_PI / teeth; + + glVertex3f(r1 * (float) cos(angle), r1 * (float) sin(angle), width * 0.5f); + glVertex3f(r1 * (float) cos(angle), r1 * (float) sin(angle), -width * 0.5f); + u = r2 * (float) cos(angle + da) - r1 * (float) cos(angle); + v = r2 * (float) sin(angle + da) - r1 * (float) sin(angle); + len = (float) sqrt(u * u + v * v); + u /= len; + v /= len; + glNormal3f(v, -u, 0.0); + glVertex3f(r2 * (float) cos(angle + da), r2 * (float) sin(angle + da), width * 0.5f); + glVertex3f(r2 * (float) cos(angle + da), r2 * (float) sin(angle + da), -width * 0.5f); + glNormal3f((float) cos(angle), (float) sin(angle), 0.f); + glVertex3f(r2 * (float) cos(angle + 2 * da), r2 * (float) sin(angle + 2 * da), width * 0.5f); + glVertex3f(r2 * (float) cos(angle + 2 * da), r2 * (float) sin(angle + 2 * da), -width * 0.5f); + u = r1 * (float) cos(angle + 3 * da) - r2 * (float) cos(angle + 2 * da); + v = r1 * (float) sin(angle + 3 * da) - r2 * (float) sin(angle + 2 * da); + glNormal3f(v, -u, 0.f); + glVertex3f(r1 * (float) cos(angle + 3 * da), r1 * (float) sin(angle + 3 * da), width * 0.5f); + glVertex3f(r1 * (float) cos(angle + 3 * da), r1 * (float) sin(angle + 3 * da), -width * 0.5f); + glNormal3f((float) cos(angle), (float) sin(angle), 0.f); + } + + glVertex3f(r1 * (float) cos(0), r1 * (float) sin(0), width * 0.5f); + glVertex3f(r1 * (float) cos(0), r1 * (float) sin(0), -width * 0.5f); + + glEnd(); + + glShadeModel(GL_SMOOTH); + + /* draw inside radius cylinder */ + glBegin(GL_QUAD_STRIP); + for (i = 0; i <= teeth; i++) { + angle = i * 2.f * (float) M_PI / teeth; + glNormal3f(-(float) cos(angle), -(float) sin(angle), 0.f); + glVertex3f(r0 * (float) cos(angle), r0 * (float) sin(angle), -width * 0.5f); + glVertex3f(r0 * (float) cos(angle), r0 * (float) sin(angle), width * 0.5f); + } + glEnd(); + +} + + +static GLfloat view_rotx = 20.f, view_roty = 30.f, view_rotz = 0.f; +static GLint gear1, gear2, gear3; +static GLfloat angle = 0.f; + +/* OpenGL draw function & timing */ +static void draw(void) +{ + glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); + + glPushMatrix(); + glRotatef(view_rotx, 1.0, 0.0, 0.0); + glRotatef(view_roty, 0.0, 1.0, 0.0); + glRotatef(view_rotz, 0.0, 0.0, 1.0); + + glPushMatrix(); + glTranslatef(-3.0, -2.0, 0.0); + glRotatef(angle, 0.0, 0.0, 1.0); + glCallList(gear1); + glPopMatrix(); + + glPushMatrix(); + glTranslatef(3.1f, -2.f, 0.f); + glRotatef(-2.f * angle - 9.f, 0.f, 0.f, 1.f); + glCallList(gear2); + glPopMatrix(); + + glPushMatrix(); + glTranslatef(-3.1f, 4.2f, 0.f); + glRotatef(-2.f * angle - 25.f, 0.f, 0.f, 1.f); + glCallList(gear3); + glPopMatrix(); + + glPopMatrix(); +} + + +/* update animation parameters */ +static void animate(void) +{ + angle = 100.f * (float) glfwGetTime(); +} + + +/* change view angle, exit upon ESC */ +void key( GLFWwindow* window, int k, int s, int action, int mods ) +{ + if( action != GLFW_PRESS ) return; + + switch (k) { + case GLFW_KEY_Z: + if( mods & GLFW_MOD_SHIFT ) + view_rotz -= 5.0; + else + view_rotz += 5.0; + break; + case GLFW_KEY_ESCAPE: + glfwSetWindowShouldClose(window, GL_TRUE); + break; + case GLFW_KEY_UP: + view_rotx += 5.0; + break; + case GLFW_KEY_DOWN: + view_rotx -= 5.0; + break; + case GLFW_KEY_LEFT: + view_roty += 5.0; + break; + case GLFW_KEY_RIGHT: + view_roty -= 5.0; + break; + default: + return; + } +} + + +/* new window size */ +void reshape( GLFWwindow* window, int width, int height ) +{ + GLfloat h = (GLfloat) height / (GLfloat) width; + GLfloat xmax, znear, zfar; + + znear = 5.0f; + zfar = 30.0f; + xmax = znear * 0.5f; + + glViewport( 0, 0, (GLint) width, (GLint) height ); + glMatrixMode( GL_PROJECTION ); + glLoadIdentity(); + glFrustum( -xmax, xmax, -xmax*h, xmax*h, znear, zfar ); + glMatrixMode( GL_MODELVIEW ); + glLoadIdentity(); + glTranslatef( 0.0, 0.0, -20.0 ); +} + + +/* program & OpenGL initialization */ +static void init(int argc, char *argv[]) +{ + static GLfloat pos[4] = {5.f, 5.f, 10.f, 0.f}; + static GLfloat red[4] = {0.8f, 0.1f, 0.f, 1.f}; + static GLfloat green[4] = {0.f, 0.8f, 0.2f, 1.f}; + static GLfloat blue[4] = {0.2f, 0.2f, 1.f, 1.f}; + GLint i; + + glLightfv(GL_LIGHT0, GL_POSITION, pos); + glEnable(GL_CULL_FACE); + glEnable(GL_LIGHTING); + glEnable(GL_LIGHT0); + glEnable(GL_DEPTH_TEST); + + /* make the gears */ + gear1 = glGenLists(1); + glNewList(gear1, GL_COMPILE); + glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, red); + gear(1.f, 4.f, 1.f, 20, 0.7f); + glEndList(); + + gear2 = glGenLists(1); + glNewList(gear2, GL_COMPILE); + glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, green); + gear(0.5f, 2.f, 2.f, 10, 0.7f); + glEndList(); + + gear3 = glGenLists(1); + glNewList(gear3, GL_COMPILE); + glMaterialfv(GL_FRONT, GL_AMBIENT_AND_DIFFUSE, blue); + gear(1.3f, 2.f, 0.5f, 10, 0.7f); + glEndList(); + + glEnable(GL_NORMALIZE); + + for ( i=1; i +#include +#include +#include +#include +#include "getopt.h" + +#include +#include + +/* OpenGL function pointers */ +static PFNGLGENBUFFERSPROC pglGenBuffers = NULL; +static PFNGLGENVERTEXARRAYSPROC pglGenVertexArrays = NULL; +static PFNGLDELETEVERTEXARRAYSPROC pglDeleteVertexArrays = NULL; +static PFNGLCREATESHADERPROC pglCreateShader = NULL; +static PFNGLSHADERSOURCEPROC pglShaderSource = NULL; +static PFNGLCOMPILESHADERPROC pglCompileShader = NULL; +static PFNGLGETSHADERIVPROC pglGetShaderiv = NULL; +static PFNGLGETSHADERINFOLOGPROC pglGetShaderInfoLog = NULL; +static PFNGLDELETESHADERPROC pglDeleteShader = NULL; +static PFNGLCREATEPROGRAMPROC pglCreateProgram = NULL; +static PFNGLATTACHSHADERPROC pglAttachShader = NULL; +static PFNGLLINKPROGRAMPROC pglLinkProgram = NULL; +static PFNGLUSEPROGRAMPROC pglUseProgram = NULL; +static PFNGLGETPROGRAMIVPROC pglGetProgramiv = NULL; +static PFNGLGETPROGRAMINFOLOGPROC pglGetProgramInfoLog = NULL; +static PFNGLDELETEPROGRAMPROC pglDeleteProgram = NULL; +static PFNGLGETUNIFORMLOCATIONPROC pglGetUniformLocation = NULL; +static PFNGLUNIFORMMATRIX4FVPROC pglUniformMatrix4fv = NULL; +static PFNGLGETATTRIBLOCATIONPROC pglGetAttribLocation = NULL; +static PFNGLBINDVERTEXARRAYPROC pglBindVertexArray = NULL; +static PFNGLBUFFERDATAPROC pglBufferData = NULL; +static PFNGLBINDBUFFERPROC pglBindBuffer = NULL; +static PFNGLBUFFERSUBDATAPROC pglBufferSubData = NULL; +static PFNGLENABLEVERTEXATTRIBARRAYPROC pglEnableVertexAttribArray = NULL; +static PFNGLVERTEXATTRIBPOINTERPROC pglVertexAttribPointer = NULL; + +/* Map height updates */ +#define MAX_CIRCLE_SIZE (5.0f) +#define MAX_DISPLACEMENT (1.0f) +#define DISPLACEMENT_SIGN_LIMIT (0.3f) +#define MAX_ITER (200) +#define NUM_ITER_AT_A_TIME (1) + +/* Map general information */ +#define MAP_SIZE (10.0f) +#define MAP_NUM_VERTICES (80) +#define MAP_NUM_TOTAL_VERTICES (MAP_NUM_VERTICES*MAP_NUM_VERTICES) +#define MAP_NUM_LINES (3* (MAP_NUM_VERTICES - 1) * (MAP_NUM_VERTICES - 1) + \ + 2 * (MAP_NUM_VERTICES - 1)) + + +/* OpenGL function pointers */ + +#define RESOLVE_GL_FCN(type, var, name) \ + if (status == GL_TRUE) \ + {\ + var = (type) glfwGetProcAddress((name));\ + if ((var) == NULL)\ + {\ + status = GL_FALSE;\ + }\ + } + + +static GLboolean init_opengl(void) +{ + GLboolean status = GL_TRUE; + RESOLVE_GL_FCN(PFNGLCREATESHADERPROC, pglCreateShader, "glCreateShader"); + RESOLVE_GL_FCN(PFNGLSHADERSOURCEPROC, pglShaderSource, "glShaderSource"); + RESOLVE_GL_FCN(PFNGLCOMPILESHADERPROC, pglCompileShader, "glCompileShader"); + RESOLVE_GL_FCN(PFNGLGETSHADERIVPROC, pglGetShaderiv, "glGetShaderiv"); + RESOLVE_GL_FCN(PFNGLGETSHADERINFOLOGPROC, pglGetShaderInfoLog, "glGetShaderInfoLog"); + RESOLVE_GL_FCN(PFNGLDELETESHADERPROC, pglDeleteShader, "glDeleteShader"); + RESOLVE_GL_FCN(PFNGLCREATEPROGRAMPROC, pglCreateProgram, "glCreateProgram"); + RESOLVE_GL_FCN(PFNGLATTACHSHADERPROC, pglAttachShader, "glAttachShader"); + RESOLVE_GL_FCN(PFNGLLINKPROGRAMPROC, pglLinkProgram, "glLinkProgram"); + RESOLVE_GL_FCN(PFNGLUSEPROGRAMPROC, pglUseProgram, "glUseProgram"); + RESOLVE_GL_FCN(PFNGLGETPROGRAMIVPROC, pglGetProgramiv, "glGetProgramiv"); + RESOLVE_GL_FCN(PFNGLGETPROGRAMINFOLOGPROC, pglGetProgramInfoLog, "glGetProgramInfoLog"); + RESOLVE_GL_FCN(PFNGLDELETEPROGRAMPROC, pglDeleteProgram, "glDeleteProgram"); + RESOLVE_GL_FCN(PFNGLGETUNIFORMLOCATIONPROC, pglGetUniformLocation, "glGetUniformLocation"); + RESOLVE_GL_FCN(PFNGLUNIFORMMATRIX4FVPROC, pglUniformMatrix4fv, "glUniformMatrix4fv"); + RESOLVE_GL_FCN(PFNGLGETATTRIBLOCATIONPROC, pglGetAttribLocation, "glGetAttribLocation"); + RESOLVE_GL_FCN(PFNGLGENVERTEXARRAYSPROC, pglGenVertexArrays, "glGenVertexArrays"); + RESOLVE_GL_FCN(PFNGLDELETEVERTEXARRAYSPROC, pglDeleteVertexArrays, "glDeleteVertexArrays"); + RESOLVE_GL_FCN(PFNGLBINDVERTEXARRAYPROC, pglBindVertexArray, "glBindVertexArray"); + RESOLVE_GL_FCN(PFNGLGENBUFFERSPROC, pglGenBuffers, "glGenBuffers"); + RESOLVE_GL_FCN(PFNGLBINDBUFFERPROC, pglBindBuffer, "glBindBuffer"); + RESOLVE_GL_FCN(PFNGLBUFFERDATAPROC, pglBufferData, "glBufferData"); + RESOLVE_GL_FCN(PFNGLBUFFERSUBDATAPROC, pglBufferSubData, "glBufferSubData"); + RESOLVE_GL_FCN(PFNGLENABLEVERTEXATTRIBARRAYPROC, pglEnableVertexAttribArray, "glEnableVertexAttribArray"); + RESOLVE_GL_FCN(PFNGLVERTEXATTRIBPOINTERPROC, pglVertexAttribPointer, "glVertexAttribPointer"); + return status; +} +/********************************************************************** + * Default shader programs + *********************************************************************/ + +static const char* default_vertex_shader = +"#version 150\n" +"uniform mat4 project;\n" +"uniform mat4 modelview;\n" +"in float x;\n" +"in float y;\n" +"in float z;\n" +"\n" +"void main()\n" +"{\n" +" gl_Position = project * modelview * vec4(x, y, z, 1.0);\n" +"}\n"; + +static const char* default_fragment_shader = +"#version 150\n" +"out vec4 gl_FragColor;\n" +"void main()\n" +"{\n" +" gl_FragColor = vec4(0.2, 1.0, 0.2, 1.0); \n" +"}\n"; + +/********************************************************************** + * Values for shader uniforms + *********************************************************************/ + +/* Frustum configuration */ +static GLfloat view_angle = 45.0f; +static GLfloat aspect_ratio = 4.0f/3.0f; +static GLfloat z_near = 1.0f; +static GLfloat z_far = 100.f; + +/* Projection matrix */ +static GLfloat projection_matrix[16] = { + 1.0f, 0.0f, 0.0f, 0.0f, + 0.0f, 1.0f, 0.0f, 0.0f, + 0.0f, 0.0f, 1.0f, 0.0f, + 0.0f, 0.0f, 0.0f, 1.0f +}; + +/* Model view matrix */ +static GLfloat modelview_matrix[16] = { + 1.0f, 0.0f, 0.0f, 0.0f, + 0.0f, 1.0f, 0.0f, 0.0f, + 0.0f, 0.0f, 1.0f, 0.0f, + 0.0f, 0.0f, 0.0f, 1.0f +}; + +/********************************************************************** + * Heightmap vertex and index data + *********************************************************************/ + +static GLfloat map_vertices[3][MAP_NUM_TOTAL_VERTICES]; +static GLuint map_line_indices[2*MAP_NUM_LINES]; + +/* Store uniform location for the shaders + * Those values are setup as part of the process of creating + * the shader program. They should not be used before creating + * the program. + */ +static GLuint mesh; +static GLuint mesh_vbo[4]; + +/********************************************************************** + * OpenGL helper functions + *********************************************************************/ + +/* Load a (text) file into memory and return its contents + */ +static char* read_file_content(const char* filename) +{ + FILE* fd; + size_t size = 0; + char* result = NULL; + + fd = fopen(filename, "r"); + if (fd != NULL) + { + size = fseek(fd, 0, SEEK_END); + (void) fseek(fd, 0, SEEK_SET); + + result = malloc(size + 1); + result[size] = '\0'; + if (fread(result, size, 1, fd) != 1) + { + free(result); + result = NULL; + } + (void) fclose(fd); + } + return result; +} + +/* Creates a shader object of the specified type using the specified text + */ +static GLuint make_shader(GLenum type, const char* shader_src) +{ + GLuint shader; + GLint shader_ok; + GLsizei log_length; + char info_log[8192]; + + shader = pglCreateShader(type); + if (shader != 0) + { + pglShaderSource(shader, 1, (const GLchar**)&shader_src, NULL); + pglCompileShader(shader); + pglGetShaderiv(shader, GL_COMPILE_STATUS, &shader_ok); + if (shader_ok != GL_TRUE) + { + fprintf(stderr, "ERROR: Failed to compile %s shader\n", (type == GL_FRAGMENT_SHADER) ? "fragment" : "vertex" ); + pglGetShaderInfoLog(shader, 8192, &log_length,info_log); + fprintf(stderr, "ERROR: \n%s\n\n", info_log); + pglDeleteShader(shader); + shader = 0; + } + } + return shader; +} + +/* Creates a program object using the specified vertex and fragment text + */ +static GLuint make_shader_program(const char* vertex_shader_src, const char* fragment_shader_src) +{ + GLuint program = 0u; + GLint program_ok; + GLuint vertex_shader = 0u; + GLuint fragment_shader = 0u; + GLsizei log_length; + char info_log[8192]; + + vertex_shader = make_shader(GL_VERTEX_SHADER, (vertex_shader_src == NULL) ? default_vertex_shader : vertex_shader_src); + if (vertex_shader != 0u) + { + fragment_shader = make_shader(GL_FRAGMENT_SHADER, (fragment_shader_src == NULL) ? default_fragment_shader : fragment_shader_src); + if (fragment_shader != 0u) + { + /* make the program that connect the two shader and link it */ + program = pglCreateProgram(); + if (program != 0u) + { + /* attach both shader and link */ + pglAttachShader(program, vertex_shader); + pglAttachShader(program, fragment_shader); + pglLinkProgram(program); + pglGetProgramiv(program, GL_LINK_STATUS, &program_ok); + + if (program_ok != GL_TRUE) + { + fprintf(stderr, "ERROR, failed to link shader program\n"); + pglGetProgramInfoLog(program, 8192, &log_length, info_log); + fprintf(stderr, "ERROR: \n%s\n\n", info_log); + pglDeleteProgram(program); + pglDeleteShader(fragment_shader); + pglDeleteShader(vertex_shader); + program = 0u; + } + } + } + else + { + fprintf(stderr, "ERROR: Unable to load fragment shader\n"); + pglDeleteShader(vertex_shader); + } + } + else + { + fprintf(stderr, "ERROR: Unable to load vertex shader\n"); + } + return program; +} + +/********************************************************************** + * Geometry creation functions + *********************************************************************/ + +/* Generate vertices and indices for the heightmap + */ +static void init_map(void) +{ + int i; + int j; + int k; + GLfloat step = MAP_SIZE / (MAP_NUM_VERTICES - 1); + GLfloat x = 0.0f; + GLfloat z = 0.0f; + /* Create a flat grid */ + k = 0; + for (i = 0 ; i < MAP_NUM_VERTICES ; ++i) + { + for (j = 0 ; j < MAP_NUM_VERTICES ; ++j) + { + map_vertices[0][k] = x; + map_vertices[1][k] = 0.0f; + map_vertices[2][k] = z; + z += step; + ++k; + } + x += step; + z = 0.0f; + } +#if DEBUG_ENABLED + for (i = 0 ; i < MAP_NUM_TOTAL_VERTICES ; ++i) + { + printf ("Vertice %d (%f, %f, %f)\n", + i, map_vertices[0][i], map_vertices[1][i], map_vertices[2][i]); + + } +#endif + /* create indices */ + /* line fan based on i + * i+1 + * | / i + n + 1 + * | / + * |/ + * i --- i + n + */ + + /* close the top of the square */ + k = 0; + for (i = 0 ; i < MAP_NUM_VERTICES -1 ; ++i) + { + map_line_indices[k++] = (i + 1) * MAP_NUM_VERTICES -1; + map_line_indices[k++] = (i + 2) * MAP_NUM_VERTICES -1; + } + /* close the right of the square */ + for (i = 0 ; i < MAP_NUM_VERTICES -1 ; ++i) + { + map_line_indices[k++] = (MAP_NUM_VERTICES - 1) * MAP_NUM_VERTICES + i; + map_line_indices[k++] = (MAP_NUM_VERTICES - 1) * MAP_NUM_VERTICES + i + 1; + } + + for (i = 0 ; i < (MAP_NUM_VERTICES - 1) ; ++i) + { + for (j = 0 ; j < (MAP_NUM_VERTICES - 1) ; ++j) + { + int ref = i * (MAP_NUM_VERTICES) + j; + map_line_indices[k++] = ref; + map_line_indices[k++] = ref + 1; + + map_line_indices[k++] = ref; + map_line_indices[k++] = ref + MAP_NUM_VERTICES; + + map_line_indices[k++] = ref; + map_line_indices[k++] = ref + MAP_NUM_VERTICES + 1; + } + } + +#ifdef DEBUG_ENABLED + for (k = 0 ; k < 2 * MAP_NUM_LINES ; k += 2) + { + int beg, end; + beg = map_line_indices[k]; + end = map_line_indices[k+1]; + printf ("Line %d: %d -> %d (%f, %f, %f) -> (%f, %f, %f)\n", + k / 2, beg, end, + map_vertices[0][beg], map_vertices[1][beg], map_vertices[2][beg], + map_vertices[0][end], map_vertices[1][end], map_vertices[2][end]); + } +#endif +} + +static void generate_heightmap__circle(float* center_x, float* center_y, + float* size, float* displacement) +{ + float sign; + /* random value for element in between [0-1.0] */ + *center_x = (MAP_SIZE * rand()) / (1.0f * RAND_MAX); + *center_y = (MAP_SIZE * rand()) / (1.0f * RAND_MAX); + *size = (MAX_CIRCLE_SIZE * rand()) / (1.0f * RAND_MAX); + sign = (1.0f * rand()) / (1.0f * RAND_MAX); + sign = (sign < DISPLACEMENT_SIGN_LIMIT) ? -1.0f : 1.0f; + *displacement = (sign * (MAX_DISPLACEMENT * rand())) / (1.0f * RAND_MAX); +} + +/* Run the specified number of iterations of the generation process for the + * heightmap + */ +static void update_map(int num_iter) +{ + assert(num_iter > 0); + while(num_iter) + { + /* center of the circle */ + float center_x; + float center_z; + float circle_size; + float disp; + size_t ii; + generate_heightmap__circle(¢er_x, ¢er_z, &circle_size, &disp); + disp = disp / 2.0f; + for (ii = 0u ; ii < MAP_NUM_TOTAL_VERTICES ; ++ii) + { + GLfloat dx = center_x - map_vertices[0][ii]; + GLfloat dz = center_z - map_vertices[2][ii]; + GLfloat pd = (2.0f * sqrtf((dx * dx) + (dz * dz))) / circle_size; + if (fabs(pd) <= 1.0f) + { + /* tx,tz is within the circle */ + GLfloat new_height = disp + (float) (cos(pd*3.14f)*disp); + map_vertices[1][ii] += new_height; + } + } + --num_iter; + } +} + +/********************************************************************** + * OpenGL helper functions + *********************************************************************/ + +/* Create VBO, IBO and VAO objects for the heightmap geometry and bind them to + * the specified program object + */ +static void make_mesh(GLuint program) +{ + GLuint attrloc; + + pglGenVertexArrays(1, &mesh); + pglGenBuffers(4, mesh_vbo); + pglBindVertexArray(mesh); + /* Prepare the data for drawing through a buffer inidices */ + pglBindBuffer(GL_ELEMENT_ARRAY_BUFFER, mesh_vbo[3]); + pglBufferData(GL_ELEMENT_ARRAY_BUFFER, sizeof(GLuint)* MAP_NUM_LINES * 2, map_line_indices, GL_STATIC_DRAW); + + /* Prepare the attributes for rendering */ + attrloc = pglGetAttribLocation(program, "x"); + pglBindBuffer(GL_ARRAY_BUFFER, mesh_vbo[0]); + pglBufferData(GL_ARRAY_BUFFER, sizeof(GLfloat) * MAP_NUM_TOTAL_VERTICES, &map_vertices[0][0], GL_STATIC_DRAW); + pglEnableVertexAttribArray(attrloc); + pglVertexAttribPointer(attrloc, 1, GL_FLOAT, GL_FALSE, 0, 0); + + attrloc = pglGetAttribLocation(program, "z"); + pglBindBuffer(GL_ARRAY_BUFFER, mesh_vbo[2]); + pglBufferData(GL_ARRAY_BUFFER, sizeof(GLfloat) * MAP_NUM_TOTAL_VERTICES, &map_vertices[2][0], GL_STATIC_DRAW); + pglEnableVertexAttribArray(attrloc); + pglVertexAttribPointer(attrloc, 1, GL_FLOAT, GL_FALSE, 0, 0); + + attrloc = pglGetAttribLocation(program, "y"); + pglBindBuffer(GL_ARRAY_BUFFER, mesh_vbo[1]); + pglBufferData(GL_ARRAY_BUFFER, sizeof(GLfloat) * MAP_NUM_TOTAL_VERTICES, &map_vertices[1][0], GL_DYNAMIC_DRAW); + pglEnableVertexAttribArray(attrloc); + pglVertexAttribPointer(attrloc, 1, GL_FLOAT, GL_FALSE, 0, 0); +} + +/* Update VBO vertices from source data + */ +static void update_mesh(void) +{ + pglBufferSubData(GL_ARRAY_BUFFER, 0, sizeof(GLfloat) * MAP_NUM_TOTAL_VERTICES, &map_vertices[1][0]); +} + +/********************************************************************** + * GLFW callback functions + *********************************************************************/ + +static void key_callback(GLFWwindow* window, int key, int scancode, int action, int mods) +{ + switch(key) + { + case GLFW_KEY_ESCAPE: + /* Exit program on Escape */ + glfwSetWindowShouldClose(window, GL_TRUE); + break; + } +} + +/* Print usage information */ +static void usage(void) +{ + printf("Usage: heightmap [-v ] [-f ]\n"); + printf(" heightmap [-h]\n"); +} + +int main(int argc, char** argv) +{ + GLFWwindow* window; + int ch, iter; + double dt; + double last_update_time; + int frame; + float f; + GLint uloc_modelview; + GLint uloc_project; + + char* vertex_shader_path = NULL; + char* fragment_shader_path = NULL; + char* vertex_shader_src = NULL; + char* fragment_shader_src = NULL; + GLuint shader_program; + + while ((ch = getopt(argc, argv, "f:v:h")) != -1) + { + switch (ch) + { + case 'f': + fragment_shader_path = optarg; + break; + case 'v': + vertex_shader_path = optarg; + break; + case 'h': + usage(); + exit(EXIT_SUCCESS); + default: + usage(); + exit(EXIT_FAILURE); + } + } + + if (fragment_shader_path) + { + vertex_shader_src = read_file_content(fragment_shader_path); + if (!fragment_shader_src) + { + fprintf(stderr, + "ERROR: unable to load fragment shader from '%s'\n", + fragment_shader_path); + exit(EXIT_FAILURE); + } + } + + if (vertex_shader_path) + { + vertex_shader_src = read_file_content(vertex_shader_path); + if (!vertex_shader_src) + { + fprintf(stderr, + "ERROR: unable to load vertex shader from '%s'\n", + fragment_shader_path); + exit(EXIT_FAILURE); + } + } + + if (!glfwInit()) + { + fprintf(stderr, "ERROR: Unable to initialize GLFW\n"); + usage(); + + free(vertex_shader_src); + free(fragment_shader_src); + exit(EXIT_FAILURE); + } + + glfwWindowHint(GLFW_RESIZABLE, GL_FALSE); + glfwWindowHint(GLFW_CONTEXT_VERSION_MAJOR, 3); + glfwWindowHint(GLFW_CONTEXT_VERSION_MINOR, 2); + glfwWindowHint(GLFW_OPENGL_PROFILE, GLFW_OPENGL_CORE_PROFILE); + glfwWindowHint(GLFW_OPENGL_FORWARD_COMPAT, GL_FALSE); + + window = glfwCreateWindow(800, 600, "GLFW OpenGL3 Heightmap demo", NULL, NULL); + if (! window ) + { + fprintf(stderr, "ERROR: Unable to create the OpenGL context and associated window\n"); + usage(); + + free(vertex_shader_src); + free(fragment_shader_src); + + glfwTerminate(); + exit(EXIT_FAILURE); + } + + /* Register events callback */ + glfwSetKeyCallback(window, key_callback); + + glfwMakeContextCurrent(window); + if (GL_TRUE != init_opengl()) + { + fprintf(stderr, "ERROR: unable to resolve OpenGL function pointers\n"); + free(vertex_shader_src); + free(fragment_shader_src); + + glfwTerminate(); + exit(EXIT_FAILURE); + } + /* Prepare opengl resources for rendering */ + shader_program = make_shader_program(vertex_shader_src , fragment_shader_src); + free(vertex_shader_src); + free(fragment_shader_src); + + if (shader_program == 0u) + { + fprintf(stderr, "ERROR: during creation of the shader program\n"); + usage(); + + glfwTerminate(); + exit(EXIT_FAILURE); + } + + pglUseProgram(shader_program); + uloc_project = pglGetUniformLocation(shader_program, "project"); + uloc_modelview = pglGetUniformLocation(shader_program, "modelview"); + + /* Compute the projection matrix */ + f = 1.0f / tanf(view_angle / 2.0f); + projection_matrix[0] = f / aspect_ratio; + projection_matrix[5] = f; + projection_matrix[10] = (z_far + z_near)/ (z_near - z_far); + projection_matrix[11] = -1.0f; + projection_matrix[14] = 2.0f * (z_far * z_near) / (z_near - z_far); + pglUniformMatrix4fv(uloc_project, 1, GL_FALSE, projection_matrix); + + /* Set the camera position */ + modelview_matrix[12] = -5.0f; + modelview_matrix[13] = -5.0f; + modelview_matrix[14] = -20.0f; + pglUniformMatrix4fv(uloc_modelview, 1, GL_FALSE, modelview_matrix); + + /* Create mesh data */ + init_map(); + make_mesh(shader_program); + + /* Create vao + vbo to store the mesh */ + /* Create the vbo to store all the information for the grid and the height */ + + /* setup the scene ready for rendering */ + glViewport(0, 0, 800, 600); + glClearColor(0.0f, 0.0f, 0.0f, 0.0f); + + /* main loop */ + frame = 0; + iter = 0; + last_update_time = glfwGetTime(); + + while (!glfwWindowShouldClose(window)) + { + ++frame; + /* render the next frame */ + glClear(GL_COLOR_BUFFER_BIT); + glDrawElements(GL_LINES, 2* MAP_NUM_LINES , GL_UNSIGNED_INT, 0); + + /* display and process events through callbacks */ + glfwSwapBuffers(window); + glfwPollEvents(); + /* Check the frame rate and update the heightmap if needed */ + dt = glfwGetTime(); + if ((dt - last_update_time) > 0.2) + { + /* generate the next iteration of the heightmap */ + if (iter < MAX_ITER) + { + update_map(NUM_ITER_AT_A_TIME); + update_mesh(); + iter += NUM_ITER_AT_A_TIME; + } + last_update_time = dt; + frame = 0; + } + } + + glfwTerminate(); + exit(EXIT_SUCCESS); +} + diff --git a/extern/glfw/examples/simple.c b/extern/glfw/examples/simple.c new file mode 100644 index 0000000..89eaa02 --- /dev/null +++ b/extern/glfw/examples/simple.c @@ -0,0 +1,101 @@ +//======================================================================== +// Simple GLFW example +// Copyright (c) Camilla Berglund +// +// This software is provided 'as-is', without any express or implied +// warranty. In no event will the authors be held liable for any damages +// arising from the use of this software. +// +// Permission is granted to anyone to use this software for any purpose, +// including commercial applications, and to alter it and redistribute it +// freely, subject to the following restrictions: +// +// 1. The origin of this software must not be misrepresented; you must not +// claim that you wrote the original software. If you use this software +// in a product, an acknowledgment in the product documentation would +// be appreciated but is not required. +// +// 2. Altered source versions must be plainly marked as such, and must not +// be misrepresented as being the original software. +// +// 3. This notice may not be removed or altered from any source +// distribution. +// +//======================================================================== +//! [code] + +#include + +#include +#include + +static void error_callback(int error, const char* description) +{ + fputs(description, stderr); +} + +static void key_callback(GLFWwindow* window, int key, int scancode, int action, int mods) +{ + if (key == GLFW_KEY_ESCAPE && action == GLFW_PRESS) + glfwSetWindowShouldClose(window, GL_TRUE); +} + +int main(void) +{ + GLFWwindow* window; + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + exit(EXIT_FAILURE); + + window = glfwCreateWindow(640, 480, "Simple example", NULL, NULL); + if (!window) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + glfwMakeContextCurrent(window); + + glfwSetKeyCallback(window, key_callback); + + while (!glfwWindowShouldClose(window)) + { + float ratio; + int width, height; + + glfwGetFramebufferSize(window, &width, &height); + ratio = width / (float) height; + + glViewport(0, 0, width, height); + glClear(GL_COLOR_BUFFER_BIT); + + glMatrixMode(GL_PROJECTION); + glLoadIdentity(); + glOrtho(-ratio, ratio, -1.f, 1.f, 1.f, -1.f); + glMatrixMode(GL_MODELVIEW); + + glLoadIdentity(); + glRotatef((float) glfwGetTime() * 50.f, 0.f, 0.f, 1.f); + + glBegin(GL_TRIANGLES); + glColor3f(1.f, 0.f, 0.f); + glVertex3f(-0.6f, -0.4f, 0.f); + glColor3f(0.f, 1.f, 0.f); + glVertex3f(0.6f, -0.4f, 0.f); + glColor3f(0.f, 0.f, 1.f); + glVertex3f(0.f, 0.6f, 0.f); + glEnd(); + + glfwSwapBuffers(window); + glfwPollEvents(); + } + + glfwDestroyWindow(window); + + glfwTerminate(); + exit(EXIT_SUCCESS); +} + +//! [code] diff --git a/extern/glfw/examples/splitview.c b/extern/glfw/examples/splitview.c new file mode 100644 index 0000000..30b093b --- /dev/null +++ b/extern/glfw/examples/splitview.c @@ -0,0 +1,511 @@ +//======================================================================== +// This is an example program for the GLFW library +// +// The program uses a "split window" view, rendering four views of the +// same scene in one window (e.g. uesful for 3D modelling software). This +// demo uses scissors to separete the four different rendering areas from +// each other. +// +// (If the code seems a little bit strange here and there, it may be +// because I am not a friend of orthogonal projections) +//======================================================================== + +#define GLFW_INCLUDE_GLU +#include + +#include +#include +#include + +#ifndef M_PI +#define M_PI 3.14159265358979323846 +#endif + + +//======================================================================== +// Global variables +//======================================================================== + +// Mouse position +static double xpos = 0, ypos = 0; + +// Window size +static int width, height; + +// Active view: 0 = none, 1 = upper left, 2 = upper right, 3 = lower left, +// 4 = lower right +static int active_view = 0; + +// Rotation around each axis +static int rot_x = 0, rot_y = 0, rot_z = 0; + +// Do redraw? +static int do_redraw = 1; + + +//======================================================================== +// Draw a solid torus (use a display list for the model) +//======================================================================== + +#define TORUS_MAJOR 1.5 +#define TORUS_MINOR 0.5 +#define TORUS_MAJOR_RES 32 +#define TORUS_MINOR_RES 32 + +static void drawTorus(void) +{ + static GLuint torus_list = 0; + int i, j, k; + double s, t, x, y, z, nx, ny, nz, scale, twopi; + + if (!torus_list) + { + // Start recording displaylist + torus_list = glGenLists(1); + glNewList(torus_list, GL_COMPILE_AND_EXECUTE); + + // Draw torus + twopi = 2.0 * M_PI; + for (i = 0; i < TORUS_MINOR_RES; i++) + { + glBegin(GL_QUAD_STRIP); + for (j = 0; j <= TORUS_MAJOR_RES; j++) + { + for (k = 1; k >= 0; k--) + { + s = (i + k) % TORUS_MINOR_RES + 0.5; + t = j % TORUS_MAJOR_RES; + + // Calculate point on surface + x = (TORUS_MAJOR + TORUS_MINOR * cos(s * twopi / TORUS_MINOR_RES)) * cos(t * twopi / TORUS_MAJOR_RES); + y = TORUS_MINOR * sin(s * twopi / TORUS_MINOR_RES); + z = (TORUS_MAJOR + TORUS_MINOR * cos(s * twopi / TORUS_MINOR_RES)) * sin(t * twopi / TORUS_MAJOR_RES); + + // Calculate surface normal + nx = x - TORUS_MAJOR * cos(t * twopi / TORUS_MAJOR_RES); + ny = y; + nz = z - TORUS_MAJOR * sin(t * twopi / TORUS_MAJOR_RES); + scale = 1.0 / sqrt(nx*nx + ny*ny + nz*nz); + nx *= scale; + ny *= scale; + nz *= scale; + + glNormal3f((float) nx, (float) ny, (float) nz); + glVertex3f((float) x, (float) y, (float) z); + } + } + + glEnd(); + } + + // Stop recording displaylist + glEndList(); + } + else + { + // Playback displaylist + glCallList(torus_list); + } +} + + +//======================================================================== +// Draw the scene (a rotating torus) +//======================================================================== + +static void drawScene(void) +{ + const GLfloat model_diffuse[4] = {1.0f, 0.8f, 0.8f, 1.0f}; + const GLfloat model_specular[4] = {0.6f, 0.6f, 0.6f, 1.0f}; + const GLfloat model_shininess = 20.0f; + + glPushMatrix(); + + // Rotate the object + glRotatef((GLfloat) rot_x * 0.5f, 1.0f, 0.0f, 0.0f); + glRotatef((GLfloat) rot_y * 0.5f, 0.0f, 1.0f, 0.0f); + glRotatef((GLfloat) rot_z * 0.5f, 0.0f, 0.0f, 1.0f); + + // Set model color (used for orthogonal views, lighting disabled) + glColor4fv(model_diffuse); + + // Set model material (used for perspective view, lighting enabled) + glMaterialfv(GL_FRONT, GL_DIFFUSE, model_diffuse); + glMaterialfv(GL_FRONT, GL_SPECULAR, model_specular); + glMaterialf(GL_FRONT, GL_SHININESS, model_shininess); + + // Draw torus + drawTorus(); + + glPopMatrix(); +} + + +//======================================================================== +// Draw a 2D grid (used for orthogonal views) +//======================================================================== + +static void drawGrid(float scale, int steps) +{ + int i; + float x, y; + + glPushMatrix(); + + // Set background to some dark bluish grey + glClearColor(0.05f, 0.05f, 0.2f, 0.0f); + glClear(GL_COLOR_BUFFER_BIT); + + // Setup modelview matrix (flat XY view) + glLoadIdentity(); + gluLookAt(0.0, 0.0, 1.0, + 0.0, 0.0, 0.0, + 0.0, 1.0, 0.0); + + // We don't want to update the Z-buffer + glDepthMask(GL_FALSE); + + // Set grid color + glColor3f(0.0f, 0.5f, 0.5f); + + glBegin(GL_LINES); + + // Horizontal lines + x = scale * 0.5f * (float) (steps - 1); + y = -scale * 0.5f * (float) (steps - 1); + for (i = 0; i < steps; i++) + { + glVertex3f(-x, y, 0.0f); + glVertex3f(x, y, 0.0f); + y += scale; + } + + // Vertical lines + x = -scale * 0.5f * (float) (steps - 1); + y = scale * 0.5f * (float) (steps - 1); + for (i = 0; i < steps; i++) + { + glVertex3f(x, -y, 0.0f); + glVertex3f(x, y, 0.0f); + x += scale; + } + + glEnd(); + + // Enable Z-buffer writing again + glDepthMask(GL_TRUE); + + glPopMatrix(); +} + + +//======================================================================== +// Draw all views +//======================================================================== + +static void drawAllViews(void) +{ + const GLfloat light_position[4] = {0.0f, 8.0f, 8.0f, 1.0f}; + const GLfloat light_diffuse[4] = {1.0f, 1.0f, 1.0f, 1.0f}; + const GLfloat light_specular[4] = {1.0f, 1.0f, 1.0f, 1.0f}; + const GLfloat light_ambient[4] = {0.2f, 0.2f, 0.3f, 1.0f}; + double aspect; + + // Calculate aspect of window + if (height > 0) + aspect = (double) width / (double) height; + else + aspect = 1.0; + + // Clear screen + glClearColor(0.0f, 0.0f, 0.0f, 0.0f); + glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); + + // Enable scissor test + glEnable(GL_SCISSOR_TEST); + + // Enable depth test + glEnable(GL_DEPTH_TEST); + glDepthFunc(GL_LEQUAL); + + // ** ORTHOGONAL VIEWS ** + + // For orthogonal views, use wireframe rendering + glPolygonMode(GL_FRONT_AND_BACK, GL_LINE); + + // Enable line anti-aliasing + glEnable(GL_LINE_SMOOTH); + glEnable(GL_BLEND); + glBlendFunc(GL_SRC_ALPHA, GL_ONE_MINUS_SRC_ALPHA); + + // Setup orthogonal projection matrix + glMatrixMode(GL_PROJECTION); + glLoadIdentity(); + glOrtho(-3.0 * aspect, 3.0 * aspect, -3.0, 3.0, 1.0, 50.0); + + // Upper left view (TOP VIEW) + glViewport(0, height / 2, width / 2, height / 2); + glScissor(0, height / 2, width / 2, height / 2); + glMatrixMode(GL_MODELVIEW); + glLoadIdentity(); + gluLookAt(0.0f, 10.0f, 1e-3f, // Eye-position (above) + 0.0f, 0.0f, 0.0f, // View-point + 0.0f, 1.0f, 0.0f); // Up-vector + drawGrid(0.5, 12); + drawScene(); + + // Lower left view (FRONT VIEW) + glViewport(0, 0, width / 2, height / 2); + glScissor(0, 0, width / 2, height / 2); + glMatrixMode(GL_MODELVIEW); + glLoadIdentity(); + gluLookAt(0.0f, 0.0f, 10.0f, // Eye-position (in front of) + 0.0f, 0.0f, 0.0f, // View-point + 0.0f, 1.0f, 0.0f); // Up-vector + drawGrid(0.5, 12); + drawScene(); + + // Lower right view (SIDE VIEW) + glViewport(width / 2, 0, width / 2, height / 2); + glScissor(width / 2, 0, width / 2, height / 2); + glMatrixMode(GL_MODELVIEW); + glLoadIdentity(); + gluLookAt(10.0f, 0.0f, 0.0f, // Eye-position (to the right) + 0.0f, 0.0f, 0.0f, // View-point + 0.0f, 1.0f, 0.0f); // Up-vector + drawGrid(0.5, 12); + drawScene(); + + // Disable line anti-aliasing + glDisable(GL_LINE_SMOOTH); + glDisable(GL_BLEND); + + // ** PERSPECTIVE VIEW ** + + // For perspective view, use solid rendering + glPolygonMode(GL_FRONT_AND_BACK, GL_FILL); + + // Enable face culling (faster rendering) + glEnable(GL_CULL_FACE); + glCullFace(GL_BACK); + glFrontFace(GL_CW); + + // Setup perspective projection matrix + glMatrixMode(GL_PROJECTION); + glLoadIdentity(); + gluPerspective(65.0f, aspect, 1.0f, 50.0f); + + // Upper right view (PERSPECTIVE VIEW) + glViewport(width / 2, height / 2, width / 2, height / 2); + glScissor(width / 2, height / 2, width / 2, height / 2); + glMatrixMode(GL_MODELVIEW); + glLoadIdentity(); + gluLookAt(3.0f, 1.5f, 3.0f, // Eye-position + 0.0f, 0.0f, 0.0f, // View-point + 0.0f, 1.0f, 0.0f); // Up-vector + + // Configure and enable light source 1 + glLightfv(GL_LIGHT1, GL_POSITION, light_position); + glLightfv(GL_LIGHT1, GL_AMBIENT, light_ambient); + glLightfv(GL_LIGHT1, GL_DIFFUSE, light_diffuse); + glLightfv(GL_LIGHT1, GL_SPECULAR, light_specular); + glEnable(GL_LIGHT1); + glEnable(GL_LIGHTING); + + // Draw scene + drawScene(); + + // Disable lighting + glDisable(GL_LIGHTING); + + // Disable face culling + glDisable(GL_CULL_FACE); + + // Disable depth test + glDisable(GL_DEPTH_TEST); + + // Disable scissor test + glDisable(GL_SCISSOR_TEST); + + // Draw a border around the active view + if (active_view > 0 && active_view != 2) + { + glViewport(0, 0, width, height); + + glMatrixMode(GL_PROJECTION); + glLoadIdentity(); + glOrtho(0.0, 2.0, 0.0, 2.0, 0.0, 1.0); + + glMatrixMode(GL_MODELVIEW); + glLoadIdentity(); + glTranslatef((GLfloat) ((active_view - 1) & 1), (GLfloat) (1 - (active_view - 1) / 2), 0.0f); + + glColor3f(1.0f, 1.0f, 0.6f); + + glBegin(GL_LINE_STRIP); + glVertex2i(0, 0); + glVertex2i(1, 0); + glVertex2i(1, 1); + glVertex2i(0, 1); + glVertex2i(0, 0); + glEnd(); + } +} + + +//======================================================================== +// Framebuffer size callback function +//======================================================================== + +static void framebufferSizeFun(GLFWwindow* window, int w, int h) +{ + width = w; + height = h > 0 ? h : 1; + do_redraw = 1; +} + + +//======================================================================== +// Window refresh callback function +//======================================================================== + +static void windowRefreshFun(GLFWwindow* window) +{ + do_redraw = 1; +} + + +//======================================================================== +// Mouse position callback function +//======================================================================== + +static void cursorPosFun(GLFWwindow* window, double x, double y) +{ + // Depending on which view was selected, rotate around different axes + switch (active_view) + { + case 1: + rot_x += (int) (y - ypos); + rot_z += (int) (x - xpos); + do_redraw = 1; + break; + case 3: + rot_x += (int) (y - ypos); + rot_y += (int) (x - xpos); + do_redraw = 1; + break; + case 4: + rot_y += (int) (x - xpos); + rot_z += (int) (y - ypos); + do_redraw = 1; + break; + default: + // Do nothing for perspective view, or if no view is selected + break; + } + + // Remember cursor position + xpos = x; + ypos = y; +} + + +//======================================================================== +// Mouse button callback function +//======================================================================== + +static void mouseButtonFun(GLFWwindow* window, int button, int action, int mods) +{ + if ((button == GLFW_MOUSE_BUTTON_LEFT) && action == GLFW_PRESS) + { + // Detect which of the four views was clicked + active_view = 1; + if (xpos >= width / 2) + active_view += 1; + if (ypos >= height / 2) + active_view += 2; + } + else if (button == GLFW_MOUSE_BUTTON_LEFT) + { + // Deselect any previously selected view + active_view = 0; + } + + do_redraw = 1; +} + +static void key_callback(GLFWwindow* window, int key, int scancode, int action, int mods) +{ + if (key == GLFW_KEY_ESCAPE && action == GLFW_PRESS) + glfwSetWindowShouldClose(window, GL_TRUE); +} + + +//======================================================================== +// main +//======================================================================== + +int main(void) +{ + GLFWwindow* window; + + // Initialise GLFW + if (!glfwInit()) + { + fprintf(stderr, "Failed to initialize GLFW\n"); + exit(EXIT_FAILURE); + } + + // Open OpenGL window + window = glfwCreateWindow(500, 500, "Split view demo", NULL, NULL); + if (!window) + { + fprintf(stderr, "Failed to open GLFW window\n"); + + glfwTerminate(); + exit(EXIT_FAILURE); + } + + // Set callback functions + glfwSetFramebufferSizeCallback(window, framebufferSizeFun); + glfwSetWindowRefreshCallback(window, windowRefreshFun); + glfwSetCursorPosCallback(window, cursorPosFun); + glfwSetMouseButtonCallback(window, mouseButtonFun); + glfwSetKeyCallback(window, key_callback); + + // Enable vsync + glfwMakeContextCurrent(window); + glfwSwapInterval(1); + + glfwGetFramebufferSize(window, &width, &height); + framebufferSizeFun(window, width, height); + + // Main loop + for (;;) + { + // Only redraw if we need to + if (do_redraw) + { + // Draw all views + drawAllViews(); + + // Swap buffers + glfwSwapBuffers(window); + + do_redraw = 0; + } + + // Wait for new events + glfwWaitEvents(); + + // Check if the window should be closed + if (glfwWindowShouldClose(window)) + break; + } + + // Close OpenGL window and terminate GLFW + glfwTerminate(); + + exit(EXIT_SUCCESS); +} + diff --git a/extern/glfw/examples/wave.c b/extern/glfw/examples/wave.c new file mode 100644 index 0000000..6890e85 --- /dev/null +++ b/extern/glfw/examples/wave.c @@ -0,0 +1,457 @@ +/***************************************************************************** + * Wave Simulation in OpenGL + * (C) 2002 Jakob Thomsen + * http://home.in.tum.de/~thomsen + * Modified for GLFW by Sylvain Hellegouarch - sh@programmationworld.com + * Modified for variable frame rate by Marcus Geelnard + * 2003-Jan-31: Minor cleanups and speedups / MG + * 2010-10-24: Formatting and cleanup - Camilla Berglund + *****************************************************************************/ + +#include +#include +#include + +#define GLFW_INCLUDE_GLU +#include + +#ifndef M_PI + #define M_PI 3.1415926535897932384626433832795 +#endif + +// Maximum delta T to allow for differential calculations +#define MAX_DELTA_T 0.01 + +// Animation speed (10.0 looks good) +#define ANIMATION_SPEED 10.0 + +GLfloat alpha = 210.f, beta = -70.f; +GLfloat zoom = 2.f; + +GLboolean locked = GL_FALSE; + +int cursorX; +int cursorY; + +struct Vertex +{ + GLfloat x, y, z; + GLfloat r, g, b; +}; + +#define GRIDW 50 +#define GRIDH 50 +#define VERTEXNUM (GRIDW*GRIDH) + +#define QUADW (GRIDW - 1) +#define QUADH (GRIDH - 1) +#define QUADNUM (QUADW*QUADH) + +GLuint quad[4 * QUADNUM]; +struct Vertex vertex[VERTEXNUM]; + +/* The grid will look like this: + * + * 3 4 5 + * *---*---* + * | | | + * | 0 | 1 | + * | | | + * *---*---* + * 0 1 2 + */ + +//======================================================================== +// Initialize grid geometry +//======================================================================== + +void init_vertices(void) +{ + int x, y, p; + + // Place the vertices in a grid + for (y = 0; y < GRIDH; y++) + { + for (x = 0; x < GRIDW; x++) + { + p = y * GRIDW + x; + + vertex[p].x = (GLfloat) (x - GRIDW / 2) / (GLfloat) (GRIDW / 2); + vertex[p].y = (GLfloat) (y - GRIDH / 2) / (GLfloat) (GRIDH / 2); + vertex[p].z = 0; + + if ((x % 4 < 2) ^ (y % 4 < 2)) + vertex[p].r = 0.0; + else + vertex[p].r = 1.0; + + vertex[p].g = (GLfloat) y / (GLfloat) GRIDH; + vertex[p].b = 1.f - ((GLfloat) x / (GLfloat) GRIDW + (GLfloat) y / (GLfloat) GRIDH) / 2.f; + } + } + + for (y = 0; y < QUADH; y++) + { + for (x = 0; x < QUADW; x++) + { + p = 4 * (y * QUADW + x); + + quad[p + 0] = y * GRIDW + x; // Some point + quad[p + 1] = y * GRIDW + x + 1; // Neighbor at the right side + quad[p + 2] = (y + 1) * GRIDW + x + 1; // Upper right neighbor + quad[p + 3] = (y + 1) * GRIDW + x; // Upper neighbor + } + } +} + +double dt; +double p[GRIDW][GRIDH]; +double vx[GRIDW][GRIDH], vy[GRIDW][GRIDH]; +double ax[GRIDW][GRIDH], ay[GRIDW][GRIDH]; + +//======================================================================== +// Initialize grid +//======================================================================== + +void init_grid(void) +{ + int x, y; + double dx, dy, d; + + for (y = 0; y < GRIDH; y++) + { + for (x = 0; x < GRIDW; x++) + { + dx = (double) (x - GRIDW / 2); + dy = (double) (y - GRIDH / 2); + d = sqrt(dx * dx + dy * dy); + if (d < 0.1 * (double) (GRIDW / 2)) + { + d = d * 10.0; + p[x][y] = -cos(d * (M_PI / (double)(GRIDW * 4))) * 100.0; + } + else + p[x][y] = 0.0; + + vx[x][y] = 0.0; + vy[x][y] = 0.0; + } + } +} + + +//======================================================================== +// Draw scene +//======================================================================== + +void draw_scene(GLFWwindow* window) +{ + // Clear the color and depth buffers + glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); + + // We don't want to modify the projection matrix + glMatrixMode(GL_MODELVIEW); + glLoadIdentity(); + + // Move back + glTranslatef(0.0, 0.0, -zoom); + // Rotate the view + glRotatef(beta, 1.0, 0.0, 0.0); + glRotatef(alpha, 0.0, 0.0, 1.0); + + glDrawElements(GL_QUADS, 4 * QUADNUM, GL_UNSIGNED_INT, quad); + + glfwSwapBuffers(window); +} + + +//======================================================================== +// Initialize Miscellaneous OpenGL state +//======================================================================== + +void init_opengl(void) +{ + // Use Gouraud (smooth) shading + glShadeModel(GL_SMOOTH); + + // Switch on the z-buffer + glEnable(GL_DEPTH_TEST); + + glEnableClientState(GL_VERTEX_ARRAY); + glEnableClientState(GL_COLOR_ARRAY); + glVertexPointer(3, GL_FLOAT, sizeof(struct Vertex), vertex); + glColorPointer(3, GL_FLOAT, sizeof(struct Vertex), &vertex[0].r); // Pointer to the first color + + glPointSize(2.0); + + // Background color is black + glClearColor(0, 0, 0, 0); +} + + +//======================================================================== +// Modify the height of each vertex according to the pressure +//======================================================================== + +void adjust_grid(void) +{ + int pos; + int x, y; + + for (y = 0; y < GRIDH; y++) + { + for (x = 0; x < GRIDW; x++) + { + pos = y * GRIDW + x; + vertex[pos].z = (float) (p[x][y] * (1.0 / 50.0)); + } + } +} + + +//======================================================================== +// Calculate wave propagation +//======================================================================== + +void calc_grid(void) +{ + int x, y, x2, y2; + double time_step = dt * ANIMATION_SPEED; + + // Compute accelerations + for (x = 0; x < GRIDW; x++) + { + x2 = (x + 1) % GRIDW; + for(y = 0; y < GRIDH; y++) + ax[x][y] = p[x][y] - p[x2][y]; + } + + for (y = 0; y < GRIDH; y++) + { + y2 = (y + 1) % GRIDH; + for(x = 0; x < GRIDW; x++) + ay[x][y] = p[x][y] - p[x][y2]; + } + + // Compute speeds + for (x = 0; x < GRIDW; x++) + { + for (y = 0; y < GRIDH; y++) + { + vx[x][y] = vx[x][y] + ax[x][y] * time_step; + vy[x][y] = vy[x][y] + ay[x][y] * time_step; + } + } + + // Compute pressure + for (x = 1; x < GRIDW; x++) + { + x2 = x - 1; + for (y = 1; y < GRIDH; y++) + { + y2 = y - 1; + p[x][y] = p[x][y] + (vx[x2][y] - vx[x][y] + vy[x][y2] - vy[x][y]) * time_step; + } + } +} + + +//======================================================================== +// Print errors +//======================================================================== + +static void error_callback(int error, const char* description) +{ + fprintf(stderr, "Error: %s\n", description); +} + + +//======================================================================== +// Handle key strokes +//======================================================================== + +void key_callback(GLFWwindow* window, int key, int scancode, int action, int mods) +{ + if (action != GLFW_PRESS) + return; + + switch (key) + { + case GLFW_KEY_ESCAPE: + glfwSetWindowShouldClose(window, GL_TRUE); + break; + case GLFW_KEY_SPACE: + init_grid(); + break; + case GLFW_KEY_LEFT: + alpha += 5; + break; + case GLFW_KEY_RIGHT: + alpha -= 5; + break; + case GLFW_KEY_UP: + beta -= 5; + break; + case GLFW_KEY_DOWN: + beta += 5; + break; + case GLFW_KEY_PAGE_UP: + zoom -= 0.25f; + if (zoom < 0.f) + zoom = 0.f; + break; + case GLFW_KEY_PAGE_DOWN: + zoom += 0.25f; + break; + default: + break; + } +} + + +//======================================================================== +// Callback function for mouse button events +//======================================================================== + +void mouse_button_callback(GLFWwindow* window, int button, int action, int mods) +{ + if (button != GLFW_MOUSE_BUTTON_LEFT) + return; + + if (action == GLFW_PRESS) + { + glfwSetInputMode(window, GLFW_CURSOR, GLFW_CURSOR_DISABLED); + locked = GL_TRUE; + } + else + { + locked = GL_FALSE; + glfwSetInputMode(window, GLFW_CURSOR, GLFW_CURSOR_NORMAL); + } +} + + +//======================================================================== +// Callback function for cursor motion events +//======================================================================== + +void cursor_position_callback(GLFWwindow* window, double x, double y) +{ + if (locked) + { + alpha += (GLfloat) (x - cursorX) / 10.f; + beta += (GLfloat) (y - cursorY) / 10.f; + } + + cursorX = (int) x; + cursorY = (int) y; +} + + +//======================================================================== +// Callback function for scroll events +//======================================================================== + +void scroll_callback(GLFWwindow* window, double x, double y) +{ + zoom += (float) y / 4.f; + if (zoom < 0) + zoom = 0; +} + + +//======================================================================== +// Callback function for framebuffer resize events +//======================================================================== + +void framebuffer_size_callback(GLFWwindow* window, int width, int height) +{ + float ratio = 1.f; + + if (height > 0) + ratio = (float) width / (float) height; + + // Setup viewport + glViewport(0, 0, width, height); + + // Change to the projection matrix and set our viewing volume + glMatrixMode(GL_PROJECTION); + glLoadIdentity(); + gluPerspective(60.0, ratio, 1.0, 1024.0); +} + + +//======================================================================== +// main +//======================================================================== + +int main(int argc, char* argv[]) +{ + GLFWwindow* window; + double t, dt_total, t_old; + int width, height; + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + exit(EXIT_FAILURE); + + window = glfwCreateWindow(640, 480, "Wave Simulation", NULL, NULL); + if (!window) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + glfwSetKeyCallback(window, key_callback); + glfwSetFramebufferSizeCallback(window, framebuffer_size_callback); + glfwSetMouseButtonCallback(window, mouse_button_callback); + glfwSetCursorPosCallback(window, cursor_position_callback); + glfwSetScrollCallback(window, scroll_callback); + + glfwMakeContextCurrent(window); + glfwSwapInterval(1); + + glfwGetFramebufferSize(window, &width, &height); + framebuffer_size_callback(window, width, height); + + // Initialize OpenGL + init_opengl(); + + // Initialize simulation + init_vertices(); + init_grid(); + adjust_grid(); + + // Initialize timer + t_old = glfwGetTime() - 0.01; + + while (!glfwWindowShouldClose(window)) + { + t = glfwGetTime(); + dt_total = t - t_old; + t_old = t; + + // Safety - iterate if dt_total is too large + while (dt_total > 0.f) + { + // Select iteration time step + dt = dt_total > MAX_DELTA_T ? MAX_DELTA_T : dt_total; + dt_total -= dt; + + // Calculate wave propagation + calc_grid(); + } + + // Compute height of each vertex + adjust_grid(); + + // Draw wave grid to OpenGL display + draw_scene(window); + + glfwPollEvents(); + } + + exit(EXIT_SUCCESS); +} + diff --git a/extern/glfw/include/GLFW/glfw3.h b/extern/glfw/include/GLFW/glfw3.h index de2798b..0f97738 100644 --- a/extern/glfw/include/GLFW/glfw3.h +++ b/extern/glfw/include/GLFW/glfw3.h @@ -133,10 +133,38 @@ extern "C" { /* Most GL/glu.h variants on Windows need wchar_t * OpenGL/gl.h blocks the definition of ptrdiff_t by glext.h on OS X */ -#include +#if !defined(GLFW_INCLUDE_NONE) + #include +#endif - -/* ---------------- GLFW related system specific defines ----------------- */ +/* Include the chosen client API headers. + */ +#if defined(__APPLE_CC__) + #if defined(GLFW_INCLUDE_GLCOREARB) + #include + #elif !defined(GLFW_INCLUDE_NONE) + #define GL_GLEXT_LEGACY + #include + #endif + #if defined(GLFW_INCLUDE_GLU) + #include + #endif +#else + #if defined(GLFW_INCLUDE_GLCOREARB) + #include + #elif defined(GLFW_INCLUDE_ES1) + #include + #elif defined(GLFW_INCLUDE_ES2) + #include + #elif defined(GLFW_INCLUDE_ES3) + #include + #elif !defined(GLFW_INCLUDE_NONE) + #include + #endif + #if defined(GLFW_INCLUDE_GLU) + #include + #endif +#endif #if defined(GLFW_DLL) && defined(_GLFW_BUILD_DLL) /* GLFW_DLL is defined by users of GLFW when compiling programs that will link @@ -173,35 +201,6 @@ extern "C" { /* -------------------- END SYSTEM/COMPILER SPECIFIC --------------------- */ -/* Include the chosen client API headers. - */ -#if defined(__APPLE_CC__) - #if defined(GLFW_INCLUDE_GLCOREARB) - #include - #elif !defined(GLFW_INCLUDE_NONE) - #define GL_GLEXT_LEGACY - #include - #endif - #if defined(GLFW_INCLUDE_GLU) - #include - #endif -#else - #if defined(GLFW_INCLUDE_GLCOREARB) - #include - #elif defined(GLFW_INCLUDE_ES1) - #include - #elif defined(GLFW_INCLUDE_ES2) - #include - #elif defined(GLFW_INCLUDE_ES3) - #include - #elif !defined(GLFW_INCLUDE_NONE) - #include - #endif - #if defined(GLFW_INCLUDE_GLU) - #include - #endif -#endif - /************************************************************************* * GLFW API tokens @@ -228,7 +227,7 @@ extern "C" { * API changes. * @ingroup init */ -#define GLFW_VERSION_REVISION 2 +#define GLFW_VERSION_REVISION 4 /*! @} */ /*! @name Key and button actions @@ -707,8 +706,8 @@ typedef void (* GLFWmousebuttonfun)(GLFWwindow*,int,int,int); * This is the function signature for cursor position callback functions. * * @param[in] window The window that received the event. - * @param[in] xpos The new x-coordinate of the cursor. - * @param[in] ypos The new y-coordinate of the cursor. + * @param[in] xpos The new x-coordinate, in screen coordinates, of the cursor. + * @param[in] ypos The new y-coordinate, in screen coordinates, of the cursor. * * @sa glfwSetCursorPosCallback * @@ -766,7 +765,7 @@ typedef void (* GLFWkeyfun)(GLFWwindow*,int,int,int,int); * This is the function signature for Unicode character callback functions. * * @param[in] window The window that received the event. - * @param[in] character The Unicode code point of the character. + * @param[in] codepoint The Unicode code point of the character. * * @sa glfwSetCharCallback * @@ -793,7 +792,7 @@ typedef void (* GLFWmonitorfun)(GLFWmonitor*,int); * * @ingroup monitor */ -typedef struct +typedef struct GLFWvidmode { /*! The width, in screen coordinates, of the video mode. */ @@ -823,7 +822,7 @@ typedef struct * * @ingroup monitor */ -typedef struct +typedef struct GLFWgammaramp { /*! An array of value describing the response of the red channel. */ @@ -864,10 +863,7 @@ typedef struct * * @note This function may only be called from the main thread. * - * @note This function may take several seconds to complete on some systems, - * while on other systems it may take only a fraction of a second to complete. - * - * @note **Mac OS X:** This function will change the current directory of the + * @note **OS X:** This function will change the current directory of the * application to the `Contents/Resources` subdirectory of the application's * bundle, if present. * @@ -1233,17 +1229,26 @@ GLFWAPI void glfwWindowHint(int target, int hint); * to not share resources. * @return The handle of the created window, or `NULL` if an error occurred. * + * @remarks **Windows:** Window creation will fail if the Microsoft GDI + * software OpenGL implementation is the only one available. + * * @remarks **Windows:** If the executable has an icon resource named * `GLFW_ICON,` it will be set as the icon for the window. If no such icon is * present, the `IDI_WINLOGO` icon will be used instead. * - * @remarks **Mac OS X:** The GLFW window has no icon, as it is not a document + * @remarks **OS X:** The GLFW window has no icon, as it is not a document * window, but the dock icon will be the same as the application bundle's icon. * Also, the first time a window is opened the menu bar is populated with * common commands like Hide, Quit and About. The (minimal) about dialog uses * information from the application's bundle. For more information on bundles, * see the Bundle Programming Guide provided by Apple. * + * @remarks **X11:** There is no mechanism for setting the window icon yet. + * + * @remarks The swap interval is not set during window creation, but is left at + * the default value for that platform. For more information, see @ref + * glfwSwapInterval. + * * @note This function may only be called from the main thread. * * @sa glfwDestroyWindow @@ -1355,10 +1360,6 @@ GLFWAPI void glfwGetWindowPos(GLFWwindow* window, int* xpos, int* ypos); * * @note The window manager may put limits on what positions are allowed. * - * @bug **X11:** Some window managers ignore the set position of hidden (i.e. - * unmapped) windows, instead placing them where it thinks is appropriate once - * they are shown. - * * @sa glfwGetWindowPos * * @ingroup window @@ -1368,7 +1369,8 @@ GLFWAPI void glfwSetWindowPos(GLFWwindow* window, int xpos, int ypos); /*! @brief Retrieves the size of the client area of the specified window. * * This function retrieves the size, in screen coordinates, of the client area - * of the specified window. + * of the specified window. If you wish to retrieve the size of the + * framebuffer in pixels, see @ref glfwGetFramebufferSize. * * @param[in] window The window whose size to retrieve. * @param[out] width Where to store the width, in screen coordinates, of the @@ -1409,7 +1411,8 @@ GLFWAPI void glfwSetWindowSize(GLFWwindow* window, int width, int height); /*! @brief Retrieves the size of the framebuffer of the specified window. * * This function retrieves the size, in pixels, of the framebuffer of the - * specified window. + * specified window. If you wish to retrieve the size of the window in screen + * coordinates, see @ref glfwGetWindowSize. * * @param[in] window The window whose framebuffer to query. * @param[out] width Where to store the width, in pixels, of the framebuffer, @@ -1592,7 +1595,10 @@ GLFWAPI GLFWwindowsizefun glfwSetWindowSizeCallback(GLFWwindow* window, GLFWwind * @return The previously set callback, or `NULL` if no callback was set or an * error occurred. * - * @remarks **Mac OS X:** Selecting Quit from the application menu will + * @par New in GLFW 3 + * The close callback no longer returns a value. + * + * @remarks **OS X:** Selecting Quit from the application menu will * trigger the close callback for all windows. * * @ingroup window @@ -1685,6 +1691,12 @@ GLFWAPI GLFWframebuffersizefun glfwSetFramebufferSizeCallback(GLFWwindow* window * This function is no longer called by @ref glfwSwapBuffers. You need to call * it or @ref glfwWaitEvents yourself. * + * @remarks On some platforms, a window move, resize or menu operation will + * cause event processing to block. This is due to how event processing is + * designed on those platforms. You can use the + * [window refresh callback](@ref GLFWwindowrefreshfun) to redraw the contents + * of your window when necessary during the operation. + * * @note This function may only be called from the main thread. * * @note This function may not be called from a callback. @@ -1712,6 +1724,12 @@ GLFWAPI void glfwPollEvents(void); * * This function is not required for joystick input to work. * + * @remarks On some platforms, a window move, resize or menu operation will + * cause event processing to block. This is due to how event processing is + * designed on those platforms. You can use the + * [window refresh callback](@ref GLFWwindowrefreshfun) to redraw the contents + * of your window when necessary during the operation. + * * @note This function may only be called from the main thread. * * @note This function may not be called from a callback. @@ -1747,9 +1765,12 @@ GLFWAPI int glfwGetInputMode(GLFWwindow* window, int mode); * modes: * - `GLFW_CURSOR_NORMAL` makes the cursor visible and behaving normally. * - `GLFW_CURSOR_HIDDEN` makes the cursor invisible when it is over the client - * area of the window. - * - `GLFW_CURSOR_DISABLED` disables the cursor and removes any limitations on - * cursor movement. + * area of the window but does not restrict the cursor from leaving. This is + * useful if you wish to render your own cursor or have no visible cursor at + * all. + * - `GLFW_CURSOR_DISABLED` hides and grabs the cursor, providing virtual + * and unlimited cursor movement. This is useful for implementing for + * example 3D camera controls. * * If `mode` is `GLFW_STICKY_KEYS`, the value must be either `GL_TRUE` to * enable sticky keys, or `GL_FALSE` to disable it. If sticky keys are @@ -1819,7 +1840,8 @@ GLFWAPI int glfwGetMouseButton(GLFWwindow* window, int button); /*! @brief Retrieves the last reported cursor position, relative to the client * area of the window. * - * This function returns the last reported position of the cursor to the + * This function returns the last reported position of the cursor, in screen + * coordinates, relative to the upper-left corner of the client area of the * specified window. * * If the cursor is disabled (with `GLFW_CURSOR_DISABLED`) then the cursor @@ -1842,11 +1864,13 @@ GLFWAPI int glfwGetMouseButton(GLFWwindow* window, int button); */ GLFWAPI void glfwGetCursorPos(GLFWwindow* window, double* xpos, double* ypos); -/*! @brief Sets the position of the cursor, relative to the client area of the window. +/*! @brief Sets the position of the cursor, relative to the client area of the + * window. * - * This function sets the position of the cursor. The specified window must be - * focused. If the window does not have focus when this function is called, it - * fails silently. + * This function sets the position, in screen coordinates, of the cursor + * relative to the upper-left corner of the client area of the specified + * window. The window must be focused. If the window does not have focus when + * this function is called, it fails silently. * * If the cursor is disabled (with `GLFW_CURSOR_DISABLED`) then the cursor * position is unbounded and limited only by the minimum and maximum values of @@ -1854,9 +1878,9 @@ GLFWAPI void glfwGetCursorPos(GLFWwindow* window, double* xpos, double* ypos); * * @param[in] window The desired window. * @param[in] xpos The desired x-coordinate, relative to the left edge of the - * client area, or `NULL`. + * client area. * @param[in] ypos The desired y-coordinate, relative to the top edge of the - * client area, or `NULL`. + * client area. * * @sa glfwGetCursorPos * @@ -1942,7 +1966,8 @@ GLFWAPI GLFWmousebuttonfun glfwSetMouseButtonCallback(GLFWwindow* window, GLFWmo * * This function sets the cursor position callback of the specified window, * which is called when the cursor is moved. The callback is provided with the - * position relative to the upper-left corner of the client area of the window. + * position, in screen coordinates, relative to the upper-left corner of the + * client area of the window. * * @param[in] window The window whose callback to set. * @param[in] cbfun The new callback, or `NULL` to remove the currently set @@ -2202,6 +2227,11 @@ GLFWAPI void glfwSwapBuffers(GLFWwindow* window); * * @remarks This function may be called from secondary threads. * + * @note This function is not called during window creation, leaving the swap + * interval set to whatever is the default on that platform. This is done + * because some swap interval extensions used by GLFW do not allow the swap + * interval to be reset to zero once it has been set to a non-zero value. + * * @note Some GPU drivers do not honor the requested swap interval, either * because of user settings that override the request or due to bugs in the * driver. diff --git a/extern/glfw/src/CMakeLists.txt b/extern/glfw/src/CMakeLists.txt index 6817192..cd699ef 100644 --- a/extern/glfw/src/CMakeLists.txt +++ b/extern/glfw/src/CMakeLists.txt @@ -3,7 +3,9 @@ include_directories(${GLFW_SOURCE_DIR}/src ${GLFW_BINARY_DIR}/src ${glfw_INCLUDE_DIRS}) -set(common_HEADERS ${GLFW_BINARY_DIR}/src/config.h internal.h +add_definitions(-D_GLFW_USE_CONFIG_H) + +set(common_HEADERS ${GLFW_BINARY_DIR}/src/glfw_config.h internal.h ${GLFW_SOURCE_DIR}/include/GLFW/glfw3.h ${GLFW_SOURCE_DIR}/include/GLFW/glfw3native.h) set(common_SOURCES clipboard.c context.c gamma.c init.c input.c joystick.c @@ -72,7 +74,8 @@ if (BUILD_SHARED_LIBS) set(glfw_CFLAGS "") endif() set_target_properties(glfw PROPERTIES - COMPILE_FLAGS "${glfw_CFLAGS} -fno-common") + COMPILE_FLAGS "${glfw_CFLAGS} -fno-common" + INSTALL_NAME_DIR "${CMAKE_INSTALL_PREFIX}/lib${LIB_SUFFIX}") endif() target_link_libraries(glfw ${glfw_LIBRARIES}) diff --git a/extern/glfw/src/cocoa_init.m b/extern/glfw/src/cocoa_init.m index 9c2813f..42b31c5 100644 --- a/extern/glfw/src/cocoa_init.m +++ b/extern/glfw/src/cocoa_init.m @@ -122,7 +122,7 @@ void _glfwPlatformTerminate(void) const char* _glfwPlatformGetVersionString(void) { - const char* version = _GLFW_VERSION_FULL " Cocoa" + const char* version = _GLFW_VERSION_NUMBER " Cocoa" #if defined(_GLFW_NSGL) " NSGL" #endif diff --git a/extern/glfw/src/cocoa_joystick.m b/extern/glfw/src/cocoa_joystick.m index 6824726..7af1042 100644 --- a/extern/glfw/src/cocoa_joystick.m +++ b/extern/glfw/src/cocoa_joystick.m @@ -251,9 +251,6 @@ static void pollJoystickEvents(void) joystick->axes[i] = value; else joystick->axes[i] = (2.f * (value - axis->minReport) / readScale) - 1.f; - - if (i & 1) - joystick->axes[i] = -joystick->axes[i]; } for (i = 0; i < CFArrayGetCount(joystick->hatElements); i++) @@ -319,8 +316,9 @@ void _glfwInitJoysticks(void) while ((ioHIDDeviceObject = IOIteratorNext(objectIterator))) { + CFMutableDictionaryRef propsRef = NULL; + CFTypeRef valueRef = NULL; kern_return_t result; - CFTypeRef valueRef = 0; IOCFPlugInInterface** ppPlugInInterface = NULL; HRESULT plugInResult = S_OK; @@ -329,26 +327,29 @@ void _glfwInitJoysticks(void) long usagePage, usage; // Check device type - valueRef = IORegistryEntryCreateCFProperty(ioHIDDeviceObject, - CFSTR(kIOHIDPrimaryUsagePageKey), + result = IORegistryEntryCreateCFProperties(ioHIDDeviceObject, + &propsRef, kCFAllocatorDefault, kNilOptions); + + if (result != kIOReturnSuccess) + continue; + + valueRef = CFDictionaryGetValue(propsRef, CFSTR(kIOHIDPrimaryUsagePageKey)); if (valueRef) { CFNumberGetValue(valueRef, kCFNumberLongType, &usagePage); if (usagePage != kHIDPage_GenericDesktop) { // This device is not relevant to GLFW + CFRelease(valueRef); continue; } CFRelease(valueRef); } - valueRef = IORegistryEntryCreateCFProperty(ioHIDDeviceObject, - CFSTR(kIOHIDPrimaryUsageKey), - kCFAllocatorDefault, - kNilOptions); + valueRef = CFDictionaryGetValue(propsRef, CFSTR(kIOHIDPrimaryUsageKey)); if (valueRef) { CFNumberGetValue(valueRef, kCFNumberLongType, &usage); @@ -358,6 +359,7 @@ void _glfwInitJoysticks(void) usage != kHIDUsage_GD_MultiAxisController)) { // This device is not relevant to GLFW + CFRelease(valueRef); continue; } @@ -393,10 +395,7 @@ void _glfwInitJoysticks(void) joystick); // Get product string - valueRef = IORegistryEntryCreateCFProperty(ioHIDDeviceObject, - CFSTR(kIOHIDProductKey), - kCFAllocatorDefault, - kNilOptions); + valueRef = CFDictionaryGetValue(propsRef, CFSTR(kIOHIDProductKey)); if (valueRef) { CFStringGetCString(valueRef, @@ -410,10 +409,7 @@ void _glfwInitJoysticks(void) joystick->buttonElements = CFArrayCreateMutable(NULL, 0, NULL); joystick->hatElements = CFArrayCreateMutable(NULL, 0, NULL); - valueRef = IORegistryEntryCreateCFProperty(ioHIDDeviceObject, - CFSTR(kIOHIDElementKey), - kCFAllocatorDefault, - kNilOptions); + valueRef = CFDictionaryGetValue(propsRef, CFSTR(kIOHIDElementKey)); if (CFGetTypeID(valueRef) == CFArrayGetTypeID()) { CFRange range = { 0, CFArrayGetCount(valueRef) }; diff --git a/extern/glfw/src/cocoa_monitor.m b/extern/glfw/src/cocoa_monitor.m index 190c1cd..caddde4 100644 --- a/extern/glfw/src/cocoa_monitor.m +++ b/extern/glfw/src/cocoa_monitor.m @@ -31,6 +31,9 @@ #include #include +#include +#include +#include // Get the name of the specified display @@ -46,9 +49,11 @@ static const char* getDisplayName(CGDirectDisplayID displayID) kIODisplayOnlyPreferredName); names = CFDictionaryGetValue(info, CFSTR(kDisplayProductName)); - if (!CFDictionaryGetValueIfPresent(names, CFSTR("en_US"), - (const void**) &value)) + if (!names || !CFDictionaryGetValueIfPresent(names, CFSTR("en_US"), + (const void**) &value)) { + _glfwInputError(GLFW_PLATFORM_ERROR, "Failed to retrieve display name"); + CFRelease(info); return strdup("Unknown"); } @@ -74,9 +79,6 @@ static GLboolean modeIsGood(CGDisplayModeRef mode) if (flags & kDisplayModeInterlacedFlag) return GL_FALSE; - if (flags & kDisplayModeTelevisionFlag) - return GL_FALSE; - if (flags & kDisplayModeStretchedFlag) return GL_FALSE; @@ -94,13 +96,21 @@ static GLboolean modeIsGood(CGDisplayModeRef mode) // Convert Core Graphics display mode to GLFW video mode // -static GLFWvidmode vidmodeFromCGDisplayMode(CGDisplayModeRef mode) +static GLFWvidmode vidmodeFromCGDisplayMode(CGDisplayModeRef mode, + CVDisplayLinkRef link) { GLFWvidmode result; - result.width = CGDisplayModeGetWidth(mode); - result.height = CGDisplayModeGetHeight(mode); + result.width = (int) CGDisplayModeGetWidth(mode); + result.height = (int) CGDisplayModeGetHeight(mode); result.refreshRate = (int) CGDisplayModeGetRefreshRate(mode); + if (result.refreshRate == 0) + { + const CVTime time = CVDisplayLinkGetNominalOutputVideoRefreshPeriod(link); + if (!(time.flags & kCVTimeIsIndefinite)) + result.refreshRate = (int) (time.timeScale / (double) time.timeValue); + } + CFStringRef format = CGDisplayModeCopyPixelEncoding(mode); if (CFStringCompare(format, CFSTR(IO16BitDirectPixels), 0) == 0) @@ -334,6 +344,9 @@ GLFWvidmode* _glfwPlatformGetVideoModes(_GLFWmonitor* monitor, int* found) CFArrayRef modes; CFIndex count, i; GLFWvidmode* result; + CVDisplayLinkRef link; + + CVDisplayLinkCreateWithCGDisplay(monitor->ns.displayID, &link); modes = CGDisplayCopyAllDisplayModes(monitor->ns.displayID, NULL); count = CFArrayGetCount(modes); @@ -348,21 +361,28 @@ GLFWvidmode* _glfwPlatformGetVideoModes(_GLFWmonitor* monitor, int* found) mode = (CGDisplayModeRef) CFArrayGetValueAtIndex(modes, i); if (modeIsGood(mode)) { - result[*found] = vidmodeFromCGDisplayMode(mode); + result[*found] = vidmodeFromCGDisplayMode(mode, link); (*found)++; } } CFRelease(modes); + + CVDisplayLinkRelease(link); return result; } void _glfwPlatformGetVideoMode(_GLFWmonitor* monitor, GLFWvidmode *mode) { CGDisplayModeRef displayMode; + CVDisplayLinkRef link; + + CVDisplayLinkCreateWithCGDisplay(monitor->ns.displayID, &link); displayMode = CGDisplayCopyDisplayMode(monitor->ns.displayID); - *mode = vidmodeFromCGDisplayMode(displayMode); + *mode = vidmodeFromCGDisplayMode(displayMode, link); CGDisplayModeRelease(displayMode); + + CVDisplayLinkRelease(link); } diff --git a/extern/glfw/src/cocoa_platform.h b/extern/glfw/src/cocoa_platform.h index b422e13..0e92c4a 100644 --- a/extern/glfw/src/cocoa_platform.h +++ b/extern/glfw/src/cocoa_platform.h @@ -105,8 +105,6 @@ typedef struct _GLFWlibraryNS id autoreleasePool; id cursor; - GLboolean cursorHidden; - char* clipboardString; _GLFWjoy joysticks[GLFW_JOYSTICK_LAST + 1]; diff --git a/extern/glfw/src/cocoa_window.m b/extern/glfw/src/cocoa_window.m index 6bdba4b..8170194 100644 --- a/extern/glfw/src/cocoa_window.m +++ b/extern/glfw/src/cocoa_window.m @@ -30,6 +30,25 @@ #include +// Center the cursor in the view of the window +// +static void centerCursor(_GLFWwindow *window) +{ + int width, height; + _glfwPlatformGetWindowSize(window, &width, &height); + _glfwPlatformSetCursorPos(window, width / 2.0, height / 2.0); +} + +// Update the cursor to match the specified cursor mode +// +static void setModeCursor(_GLFWwindow* window, int mode) +{ + if (mode == GLFW_CURSOR_NORMAL) + [[NSCursor arrowCursor] set]; + else + [(NSCursor*) _glfw.ns.cursor set]; +} + // Enter fullscreen mode // static void enterFullscreenMode(_GLFWwindow* window) @@ -39,8 +58,18 @@ static void enterFullscreenMode(_GLFWwindow* window) _glfwSetVideoMode(window->monitor, &window->videoMode); + NSDictionary* options = [NSDictionary dictionaryWithObjectsAndKeys: + [NSNumber numberWithBool:NO], + NSFullScreenModeAllScreens, + nil]; + [window->ns.view enterFullScreenMode:window->monitor->ns.screen - withOptions:nil]; + withOptions:options]; + + // HACK: Synthesize focus event as window does not become key when the view + // is made full screen + // TODO: Remove this when moving to a full screen window + _glfwInputWindowFocus(window, GL_TRUE); } // Leave fullscreen mode @@ -50,6 +79,11 @@ static void leaveFullscreenMode(_GLFWwindow* window) if (![window->ns.view isInFullScreenMode]) return; + // HACK: Synthesize focus event as window does not become key when the view + // is made full screen + // TODO: Remove this when moving to a full screen window + _glfwInputWindowFocus(window, GL_FALSE); + _glfwRestoreVideoMode(window->monitor); // Exit full screen after the video restore to avoid a nasty display @@ -71,7 +105,7 @@ static float transformY(float y) static NSRect convertRectToBacking(_GLFWwindow* window, NSRect contentRect) { #if MAC_OS_X_VERSION_MAX_ALLOWED >= 1070 - if (floor(NSAppKitVersionNumber) >= NSAppKitVersionNumber10_7) + if (floor(NSAppKitVersionNumber) > NSAppKitVersionNumber10_6) return [window->ns.view convertRectToBacking:contentRect]; else #endif /*MAC_OS_X_VERSION_MAX_ALLOWED*/ @@ -94,13 +128,6 @@ static NSRect convertRectToBacking(_GLFWwindow* window, NSRect contentRect) @implementation GLFWWindowDelegate -static void centerCursor(_GLFWwindow *window) -{ - int width, height; - _glfwPlatformGetWindowSize(window, &width, &height); - _glfwPlatformSetCursorPos(window, width / 2.0, height / 2.0); -} - - (id)initWithGlfwWindow:(_GLFWwindow *)initWindow { self = [super init]; @@ -159,14 +186,13 @@ static void centerCursor(_GLFWwindow *window) - (void)windowDidBecomeKey:(NSNotification *)notification { _glfwInputWindowFocus(window, GL_TRUE); - - if (window->cursorMode == GLFW_CURSOR_DISABLED) - centerCursor(window); + _glfwPlatformSetCursorMode(window, window->cursorMode); } - (void)windowDidResignKey:(NSNotification *)notification { _glfwInputWindowFocus(window, GL_FALSE); + _glfwPlatformSetCursorMode(window, GLFW_CURSOR_NORMAL); } @end @@ -240,7 +266,6 @@ static int translateFlags(NSUInteger flags) static int translateKey(unsigned int key) { // Keyboard symbol translation table - // TODO: Need to find mappings for F13-F15, volume down/up/mute, and eject. static const unsigned int table[128] = { /* 00 */ GLFW_KEY_A, @@ -253,7 +278,7 @@ static int translateKey(unsigned int key) /* 07 */ GLFW_KEY_X, /* 08 */ GLFW_KEY_C, /* 09 */ GLFW_KEY_V, - /* 0a */ GLFW_KEY_GRAVE_ACCENT, + /* 0a */ GLFW_KEY_WORLD_1, /* 0b */ GLFW_KEY_B, /* 0c */ GLFW_KEY_Q, /* 0d */ GLFW_KEY_W, @@ -293,7 +318,7 @@ static int translateKey(unsigned int key) /* 2f */ GLFW_KEY_PERIOD, /* 30 */ GLFW_KEY_TAB, /* 31 */ GLFW_KEY_SPACE, - /* 32 */ GLFW_KEY_WORLD_1, + /* 32 */ GLFW_KEY_GRAVE_ACCENT, /* 33 */ GLFW_KEY_BACKSPACE, /* 34 */ GLFW_KEY_UNKNOWN, /* 35 */ GLFW_KEY_ESCAPE, @@ -348,7 +373,7 @@ static int translateKey(unsigned int key) /* 66 */ GLFW_KEY_UNKNOWN, /* 67 */ GLFW_KEY_F11, /* 68 */ GLFW_KEY_UNKNOWN, - /* 69 */ GLFW_KEY_PRINT_SCREEN, + /* 69 */ GLFW_KEY_F13, /* 6a */ GLFW_KEY_F16, /* 6b */ GLFW_KEY_F14, /* 6c */ GLFW_KEY_UNKNOWN, @@ -445,6 +470,11 @@ static int translateKey(unsigned int key) return YES; } +- (void)cursorUpdate:(NSEvent *)event +{ + setModeCursor(window, window->cursorMode); +} + - (void)mouseDown:(NSEvent *)event { _glfwInputMouseClick(window, @@ -503,7 +533,7 @@ static int translateKey(unsigned int key) - (void)otherMouseDown:(NSEvent *)event { _glfwInputMouseClick(window, - [event buttonNumber], + (int) [event buttonNumber], GLFW_PRESS, translateFlags([event modifierFlags])); } @@ -516,7 +546,7 @@ static int translateKey(unsigned int key) - (void)otherMouseUp:(NSEvent *)event { _glfwInputMouseClick(window, - [event buttonNumber], + (int) [event buttonNumber], GLFW_RELEASE, translateFlags([event modifierFlags])); } @@ -548,7 +578,8 @@ static int translateKey(unsigned int key) } NSTrackingAreaOptions options = NSTrackingMouseEnteredAndExited | - NSTrackingActiveAlways | + NSTrackingActiveInKeyWindow | + NSTrackingCursorUpdate | NSTrackingInVisibleRect; trackingArea = [[NSTrackingArea alloc] initWithRect:[self bounds] @@ -603,7 +634,7 @@ static int translateKey(unsigned int key) double deltaX, deltaY; #if MAC_OS_X_VERSION_MAX_ALLOWED >= 1070 - if (floor(NSAppKitVersionNumber) >= NSAppKitVersionNumber10_7) + if (floor(NSAppKitVersionNumber) > NSAppKitVersionNumber10_6) { deltaX = [event scrollingDeltaX]; deltaY = [event scrollingDeltaY]; @@ -625,12 +656,6 @@ static int translateKey(unsigned int key) _glfwInputScroll(window, deltaX, deltaY); } -- (void)resetCursorRects -{ - [self discardCursorRects]; - [self addCursorRect:[self bounds] cursor:_glfw.ns.cursor]; -} - @end @@ -759,7 +784,7 @@ static void createMenuBar(void) [NSApp setWindowsMenu:windowMenu]; [windowMenuItem setSubmenu:windowMenu]; - [windowMenu addItemWithTitle:@"Miniaturize" + [windowMenu addItemWithTitle:@"Minimize" action:@selector(performMiniaturize:) keyEquivalent:@"m"]; [windowMenu addItemWithTitle:@"Zoom" @@ -770,9 +795,23 @@ static void createMenuBar(void) action:@selector(arrangeInFront:) keyEquivalent:@""]; +#if MAC_OS_X_VERSION_MAX_ALLOWED >= 1070 + if (floor(NSAppKitVersionNumber) > NSAppKitVersionNumber10_6) + { + // TODO: Make this appear at the bottom of the menu (for consistency) + + [windowMenu addItem:[NSMenuItem separatorItem]]; + [[windowMenu addItemWithTitle:@"Enter Full Screen" + action:@selector(toggleFullScreen:) + keyEquivalent:@"f"] + setKeyEquivalentModifierMask:NSControlKeyMask | NSCommandKeyMask]; + } +#endif /*MAC_OS_X_VERSION_MAX_ALLOWED*/ + // Prior to Snow Leopard, we need to use this oddly-named semi-private API // to get the application menu working properly. - [NSApp performSelector:@selector(setAppleMenu:) withObject:appMenu]; + SEL setAppleMenuSelector = NSSelectorFromString(@"setAppleMenu:"); + [NSApp performSelector:setAppleMenuSelector withObject:appMenu]; } #endif /* _GLFW_USE_MENUBAR */ @@ -787,13 +826,8 @@ static GLboolean initializeAppKit(void) // Implicitly create shared NSApplication instance [GLFWApplication sharedApplication]; - // If we get here, the application is unbundled - ProcessSerialNumber psn = { 0, kCurrentProcess }; - TransformProcessType(&psn, kProcessTransformToForegroundApplication); - - // Having the app in front of the terminal window is also generally - // handy. There is an NSApplication API to do this, but... - SetFrontProcess(&psn); + // In case we are unbundled, make us a proper UI application + [NSApp setActivationPolicy:NSApplicationActivationPolicyRegular]; #if defined(_GLFW_USE_MENUBAR) // Menu bar setup must go between sharedApplication above and @@ -840,19 +874,23 @@ static GLboolean createWindow(_GLFWwindow* window, window->ns.view = [[GLFWContentView alloc] initWithGlfwWindow:window]; #if MAC_OS_X_VERSION_MAX_ALLOWED >= 1070 - if (floor(NSAppKitVersionNumber) >= NSAppKitVersionNumber10_7) + if (floor(NSAppKitVersionNumber) > NSAppKitVersionNumber10_6) + { [window->ns.view setWantsBestResolutionOpenGLSurface:YES]; + + if (wndconfig->resizable) + [window->ns.object setCollectionBehavior:NSWindowCollectionBehaviorFullScreenPrimary]; + } #endif /*MAC_OS_X_VERSION_MAX_ALLOWED*/ [window->ns.object setTitle:[NSString stringWithUTF8String:wndconfig->title]]; [window->ns.object setContentView:window->ns.view]; [window->ns.object setDelegate:window->ns.delegate]; [window->ns.object setAcceptsMouseMovedEvents:YES]; - [window->ns.object disableCursorRects]; [window->ns.object center]; #if MAC_OS_X_VERSION_MAX_ALLOWED >= 1070 - if (floor(NSAppKitVersionNumber) >= NSAppKitVersionNumber10_7) + if (floor(NSAppKitVersionNumber) > NSAppKitVersionNumber10_6) [window->ns.object setRestorable:NO]; #endif /*MAC_OS_X_VERSION_MAX_ALLOWED*/ @@ -996,6 +1034,12 @@ void _glfwPlatformRestoreWindow(_GLFWwindow* window) void _glfwPlatformShowWindow(_GLFWwindow* window) { + // Make us the active application + // HACK: This has been moved here from initializeAppKit to prevent + // applications using only hidden windows from being activated, but + // should probably not be done every time any window is shown + [NSApp activateIgnoringOtherApps:YES]; + [window->ns.object makeKeyAndOrderFront:nil]; _glfwInputWindowVisibility(window, GL_TRUE); } @@ -1040,6 +1084,8 @@ void _glfwPlatformWaitEvents(void) void _glfwPlatformSetCursorPos(_GLFWwindow* window, double x, double y) { + setModeCursor(window, window->cursorMode); + if (window->monitor) { CGDisplayMoveCursorToPoint(window->monitor->ns.displayID, @@ -1058,37 +1104,15 @@ void _glfwPlatformSetCursorPos(_GLFWwindow* window, double x, double y) void _glfwPlatformSetCursorMode(_GLFWwindow* window, int mode) { - if (mode == GLFW_CURSOR_HIDDEN) - { - [window->ns.object enableCursorRects]; - [window->ns.object invalidateCursorRectsForView:window->ns.view]; - } - else - { - [window->ns.object disableCursorRects]; - [window->ns.object invalidateCursorRectsForView:window->ns.view]; - } + setModeCursor(window, mode); if (mode == GLFW_CURSOR_DISABLED) { CGAssociateMouseAndMouseCursorPosition(false); - - if (!_glfw.ns.cursorHidden) - { - [NSCursor hide]; - _glfw.ns.cursorHidden = GL_TRUE; - } + centerCursor(window); } else - { CGAssociateMouseAndMouseCursorPosition(true); - - if (_glfw.ns.cursorHidden) - { - [NSCursor unhide]; - _glfw.ns.cursorHidden = GL_FALSE; - } - } } diff --git a/extern/glfw/src/context.c b/extern/glfw/src/context.c index 456413b..3bc86bc 100644 --- a/extern/glfw/src/context.c +++ b/extern/glfw/src/context.c @@ -98,7 +98,7 @@ GLboolean _glfwIsValidContextConfig(_GLFWwndconfig* wndconfig) if (wndconfig->clientAPI == GLFW_OPENGL_API) { - if (wndconfig->glMajor < 1 || wndconfig->glMinor < 0 || + if ((wndconfig->glMajor < 1 || wndconfig->glMinor < 0) || (wndconfig->glMajor == 1 && wndconfig->glMinor > 5) || (wndconfig->glMajor == 2 && wndconfig->glMinor > 1) || (wndconfig->glMajor == 3 && wndconfig->glMinor > 3)) @@ -402,8 +402,8 @@ GLboolean _glfwRefreshContextAttribs(void) else if (glfwExtensionSupported("GL_ARB_debug_output")) { // HACK: This is a workaround for older drivers (pre KHR_debug) - // not setting the debug bit in the context flags for debug - // contexts + // not setting the debug bit in the context flags for + // debug contexts window->glDebug = GL_TRUE; } } @@ -419,13 +419,21 @@ GLboolean _glfwRefreshContextAttribs(void) window->glProfile = GLFW_OPENGL_COMPAT_PROFILE; else if (mask & GL_CONTEXT_CORE_PROFILE_BIT) window->glProfile = GLFW_OPENGL_CORE_PROFILE; + else if (glfwExtensionSupported("GL_ARB_compatibility")) + { + // HACK: This is a workaround for the compatibility profile bit + // not being set in the context flags if an OpenGL 3.2+ + // context was created without having requested a specific + // version + window->glProfile = GLFW_OPENGL_COMPAT_PROFILE; + } } // Read back robustness strategy if (glfwExtensionSupported("GL_ARB_robustness")) { // NOTE: We avoid using the context flags for detection, as they are - // only present from 3.0 while the extension applies from 1.1 + // only present from 3.0 while the extension applies from 1.1 GLint strategy; glGetIntegerv(GL_RESET_NOTIFICATION_STRATEGY_ARB, &strategy); @@ -442,7 +450,7 @@ GLboolean _glfwRefreshContextAttribs(void) if (glfwExtensionSupported("GL_EXT_robustness")) { // NOTE: The values of these constants match those of the OpenGL ARB - // one, so we can reuse them here + // one, so we can reuse them here GLint strategy; glGetIntegerv(GL_RESET_NOTIFICATION_STRATEGY_ARB, &strategy); @@ -566,7 +574,7 @@ GLFWAPI int glfwExtensionSupported(const char* extension) return GL_FALSE; } - if (extension == NULL || *extension == '\0') + if (!extension || *extension == '\0') { _glfwInputError(GLFW_INVALID_VALUE, NULL); return GL_FALSE; @@ -577,11 +585,15 @@ GLFWAPI int glfwExtensionSupported(const char* extension) // Check if extension is in the old style OpenGL extensions string extensions = glGetString(GL_EXTENSIONS); - if (extensions != NULL) + if (!extensions) { - if (_glfwStringInExtensionString(extension, extensions)) - return GL_TRUE; + _glfwInputError(GLFW_PLATFORM_ERROR, + "Failed to retrieve extension string"); + return GL_FALSE; } + + if (_glfwStringInExtensionString(extension, extensions)) + return GL_TRUE; } #if defined(_GLFW_USE_OPENGL) else @@ -595,11 +607,16 @@ GLFWAPI int glfwExtensionSupported(const char* extension) for (i = 0; i < count; i++) { - if (strcmp((const char*) window->GetStringi(GL_EXTENSIONS, i), - extension) == 0) - { - return GL_TRUE; - } + const char* en = (const char*) window->GetStringi(GL_EXTENSIONS, i); + if (!en) + { + _glfwInputError(GLFW_PLATFORM_ERROR, + "Failed to retrieve extension string %i", i); + return GL_FALSE; + } + + if (strcmp(en, extension) == 0) + return GL_TRUE; } } #endif // _GLFW_USE_OPENGL diff --git a/extern/glfw/src/glfw3.pc.in b/extern/glfw/src/glfw3.pc.in index 175c902..d56a494 100644 --- a/extern/glfw/src/glfw3.pc.in +++ b/extern/glfw/src/glfw3.pc.in @@ -1,7 +1,7 @@ prefix=@CMAKE_INSTALL_PREFIX@ exec_prefix=${prefix} includedir=${prefix}/include -libdir=${exec_prefix}/lib +libdir=${exec_prefix}/lib@LIB_SUFFIX@ Name: GLFW Description: A portable library for OpenGL, window and input diff --git a/extern/glfw/src/config.h.in b/extern/glfw/src/glfw_config.h.in similarity index 85% rename from extern/glfw/src/config.h.in rename to extern/glfw/src/glfw_config.h.in index 5925966..a731860 100644 --- a/extern/glfw/src/config.h.in +++ b/extern/glfw/src/glfw_config.h.in @@ -23,13 +23,15 @@ // distribution. // //======================================================================== -// As config.h.in, this file is used by CMake to produce the config.h shared -// configuration header file. If you are adding a feature requiring -// conditional compilation, this is the proper place to add the macros. +// As glfw_config.h.in, this file is used by CMake to produce the +// glfw_config.h configuration header file. If you are adding a feature +// requiring conditional compilation, this is where to add the macro. //======================================================================== -// As config.h, this file defines compile-time build options and macros for -// all platforms supported by GLFW. As this is a generated file, don't modify -// it. Instead, you should modify the config.h.in file. +// As glfw_config.h, this file defines compile-time option macros for a +// specific platform and development environment. If you are using the +// GLFW CMake files, modify glfw_config.h.in instead of this file. If you +// are using your own build system, make this file define the appropriate +// macros in whatever way is suitable. //======================================================================== // Define this to 1 if building GLFW for X11 @@ -79,6 +81,3 @@ // Define this to 1 if using OpenGL ES 2.0 as the client library #cmakedefine _GLFW_USE_GLESV2 -// The GLFW version as used by glfwGetVersionString -#define _GLFW_VERSION_FULL "@GLFW_VERSION_FULL@" - diff --git a/extern/glfw/src/glx_context.c b/extern/glfw/src/glx_context.c index 58c2575..6b87000 100644 --- a/extern/glfw/src/glx_context.c +++ b/extern/glfw/src/glx_context.c @@ -30,7 +30,6 @@ #include #include #include -#include // This is the only glXGetProcAddress variant not declared by glxext.h @@ -75,7 +74,7 @@ static GLboolean chooseFBConfig(const _GLFWfbconfig* desired, GLXFBConfig* resul if (strcmp(vendor, "Chromium") == 0) { // HACK: This is a (hopefully temporary) workaround for Chromium - // (VirtualBox GL) not setting the window bit on any GLXFBConfigs + // (VirtualBox GL) not setting the window bit on any GLXFBConfigs trustWindowBit = GL_FALSE; } @@ -457,8 +456,8 @@ int _glfwCreateContext(_GLFWwindow* window, if (wndconfig->glMajor != 1 || wndconfig->glMinor != 0) { // NOTE: Only request an explicitly versioned context when - // necessary, as explicitly requesting version 1.0 does not always - // return the highest available version + // necessary, as explicitly requesting version 1.0 does not + // always return the highest available version setGLXattrib(GLX_CONTEXT_MAJOR_VERSION_ARB, wndconfig->glMajor); setGLXattrib(GLX_CONTEXT_MINOR_VERSION_ARB, wndconfig->glMinor); @@ -485,8 +484,9 @@ int _glfwCreateContext(_GLFWwindow* window, if (window->glx.context == NULL) { // HACK: This is a fallback for the broken Mesa implementation of - // GLX_ARB_create_context_profile, which fails default 1.0 context - // creation with a GLXBadProfileARB error in violation of the spec + // GLX_ARB_create_context_profile, which fails default 1.0 + // context creation with a GLXBadProfileARB error in violation + // of the extension spec if (_glfw.x11.errorCode == _glfw.glx.errorBase + GLXBadProfileARB && wndconfig->clientAPI == GLFW_OPENGL_API && wndconfig->glProfile == GLFW_OPENGL_ANY_PROFILE && diff --git a/extern/glfw/src/glx_platform.h b/extern/glfw/src/glx_platform.h index 74e60a8..4b133a2 100644 --- a/extern/glfw/src/glx_platform.h +++ b/extern/glfw/src/glx_platform.h @@ -41,6 +41,8 @@ #include #endif +#include + // We support four different ways for getting addresses for GL/GLX // extension functions: glXGetProcAddress, glXGetProcAddressARB, // glXGetProcAddressEXT, and dlsym diff --git a/extern/glfw/src/input.c b/extern/glfw/src/input.c index 1bd7e6d..866a489 100644 --- a/extern/glfw/src/input.c +++ b/extern/glfw/src/input.c @@ -35,7 +35,7 @@ // static void setCursorMode(_GLFWwindow* window, int newMode) { - int oldMode; + const int oldMode = window->cursorMode; if (newMode != GLFW_CURSOR_NORMAL && newMode != GLFW_CURSOR_HIDDEN && @@ -45,10 +45,11 @@ static void setCursorMode(_GLFWwindow* window, int newMode) return; } - oldMode = window->cursorMode; if (oldMode == newMode) return; + window->cursorMode = newMode; + if (window == _glfw.focusedWindow) { if (oldMode == GLFW_CURSOR_DISABLED) @@ -71,8 +72,6 @@ static void setCursorMode(_GLFWwindow* window, int newMode) _glfwPlatformSetCursorMode(window, newMode); } - - window->cursorMode = newMode; } // Set sticky keys mode for the specified window @@ -149,13 +148,13 @@ void _glfwInputKey(_GLFWwindow* window, int key, int scancode, int action, int m window->callbacks.key((GLFWwindow*) window, key, scancode, action, mods); } -void _glfwInputChar(_GLFWwindow* window, unsigned int character) +void _glfwInputChar(_GLFWwindow* window, unsigned int codepoint) { - if (character < 32 || (character > 126 && character < 160)) + if (codepoint < 32 || (codepoint > 126 && codepoint < 160)) return; if (window->callbacks.character) - window->callbacks.character((GLFWwindow*) window, character); + window->callbacks.character((GLFWwindow*) window, codepoint); } void _glfwInputScroll(_GLFWwindow* window, double xoffset, double yoffset) diff --git a/extern/glfw/src/internal.h b/extern/glfw/src/internal.h index b6e2136..8a24959 100644 --- a/extern/glfw/src/internal.h +++ b/extern/glfw/src/internal.h @@ -29,7 +29,11 @@ #define _internal_h_ -#include "config.h" +#if defined(_GLFW_USE_CONFIG_H) + #include "glfw_config.h" +#endif + +#define _GLFW_VERSION_NUMBER "3.0.4" #if defined(_GLFW_USE_OPENGL) // This is the default for glfw3.h @@ -624,10 +628,10 @@ void _glfwInputKey(_GLFWwindow* window, int key, int scancode, int action, int m /*! @brief Notifies shared code of a Unicode character input event. * @param[in] window The window that received the event. - * @param[in] character The Unicode code point of the input character. + * @param[in] codepoint The Unicode code point of the input character. * @ingroup event */ -void _glfwInputChar(_GLFWwindow* window, unsigned int character); +void _glfwInputChar(_GLFWwindow* window, unsigned int codepoint); /*! @brief Notifies shared code of a scroll event. * @param[in] window The window that received the event. @@ -750,11 +754,18 @@ void _glfwAllocGammaArrays(GLFWgammaramp* ramp, unsigned int size); */ void _glfwFreeGammaArrays(GLFWgammaramp* ramp); -/*! @ingroup utility +/*! @brief Allocates and returns a monitor object with the specified name + * and dimensions. + * @param[in] name The name of the monitor. + * @param[in] widthMM The width, in mm, of the monitor's display area. + * @param[in] heightMM The height, in mm, of the monitor's display area. + * @return The newly created object. + * @ingroup utility */ _GLFWmonitor* _glfwCreateMonitor(const char* name, int widthMM, int heightMM); -/*! @ingroup utility +/*! @brief Frees a monitor object and any data associated with it. + * @ingroup utility */ void _glfwDestroyMonitor(_GLFWmonitor* monitor); diff --git a/extern/glfw/src/nsgl_context.m b/extern/glfw/src/nsgl_context.m index 2c3dcca..71638ad 100644 --- a/extern/glfw/src/nsgl_context.m +++ b/extern/glfw/src/nsgl_context.m @@ -40,7 +40,7 @@ int _glfwInitContextAPI(void) if (pthread_key_create(&_glfw.nsgl.current, NULL) != 0) { _glfwInputError(GLFW_PLATFORM_ERROR, - "NSOpenGL: Failed to create context TLS"); + "NSGL: Failed to create context TLS"); return GL_FALSE; } @@ -81,16 +81,15 @@ int _glfwCreateContext(_GLFWwindow* window, if (wndconfig->clientAPI == GLFW_OPENGL_ES_API) { _glfwInputError(GLFW_VERSION_UNAVAILABLE, - "NSOpenGL: This API does not support OpenGL ES"); + "NSGL: This API does not support OpenGL ES"); return GL_FALSE; } #if MAC_OS_X_VERSION_MAX_ALLOWED >= 1070 - // Fail if any OpenGL version above 2.1 other than 3.2 was requested if (wndconfig->glMajor == 3 && wndconfig->glMinor < 2) { _glfwInputError(GLFW_VERSION_UNAVAILABLE, - "NSOpenGL: The targeted version of OS X does not " + "NSGL: The targeted version of OS X does not " "support OpenGL 3.0 or 3.1"); return GL_FALSE; } @@ -100,7 +99,7 @@ int _glfwCreateContext(_GLFWwindow* window, if (!wndconfig->glForward) { _glfwInputError(GLFW_VERSION_UNAVAILABLE, - "NSOpenGL: The targeted version of OS X only " + "NSGL: The targeted version of OS X only " "supports OpenGL 3.2 and later versions if they " "are forward-compatible"); return GL_FALSE; @@ -109,7 +108,7 @@ int _glfwCreateContext(_GLFWwindow* window, if (wndconfig->glProfile != GLFW_OPENGL_CORE_PROFILE) { _glfwInputError(GLFW_VERSION_UNAVAILABLE, - "NSOpenGL: The targeted version of OS X only " + "NSGL: The targeted version of OS X only " "supports OpenGL 3.2 and later versions if they " "use the core profile"); return GL_FALSE; @@ -120,7 +119,7 @@ int _glfwCreateContext(_GLFWwindow* window, if (wndconfig->glMajor > 2) { _glfwInputError(GLFW_VERSION_UNAVAILABLE, - "NSOpenGL: The targeted version of OS X does not " + "NSGL: The targeted version of OS X does not " "support OpenGL version 3.0 or above"); return GL_FALSE; } @@ -130,7 +129,7 @@ int _glfwCreateContext(_GLFWwindow* window, if (wndconfig->glRobustness) { _glfwInputError(GLFW_VERSION_UNAVAILABLE, - "NSOpenGL: OS X does not support OpenGL robustness " + "NSGL: OS X does not support OpenGL robustness " "strategies"); return GL_FALSE; } @@ -179,7 +178,7 @@ int _glfwCreateContext(_GLFWwindow* window, } // NOTE: All NSOpenGLPixelFormats on the relevant cards support sRGB - // frambuffer, so there's no need (and no way) to request it + // frambuffer, so there's no need (and no way) to request it ADD_ATTR(0); @@ -191,7 +190,7 @@ int _glfwCreateContext(_GLFWwindow* window, if (window->nsgl.pixelFormat == nil) { _glfwInputError(GLFW_PLATFORM_ERROR, - "NSOpenGL: Failed to create OpenGL pixel format"); + "NSGL: Failed to create OpenGL pixel format"); return GL_FALSE; } @@ -206,7 +205,7 @@ int _glfwCreateContext(_GLFWwindow* window, if (window->nsgl.context == nil) { _glfwInputError(GLFW_PLATFORM_ERROR, - "NSOpenGL: Failed to create OpenGL context"); + "NSGL: Failed to create OpenGL context"); return GL_FALSE; } diff --git a/extern/glfw/src/wgl_context.c b/extern/glfw/src/wgl_context.c index ccd7f57..0b3610b 100644 --- a/extern/glfw/src/wgl_context.c +++ b/extern/glfw/src/wgl_context.c @@ -272,9 +272,21 @@ static GLboolean choosePixelFormat(_GLFWwindow* window, usableCount++; } + if (!usableCount) + { + _glfwInputError(GLFW_API_UNAVAILABLE, + "WGL: The driver does not appear to support OpenGL"); + + free(usableConfigs); + return GL_FALSE; + } + closest = _glfwChooseFBConfig(desired, usableConfigs, usableCount); if (!closest) { + _glfwInputError(GLFW_PLATFORM_ERROR, + "WGL: Failed to find a suitable pixel format"); + free(usableConfigs); return GL_FALSE; } @@ -355,11 +367,7 @@ int _glfwCreateContext(_GLFWwindow* window, } if (!choosePixelFormat(window, fbconfig, &pixelFormat)) - { - _glfwInputError(GLFW_PLATFORM_ERROR, - "WGL: Failed to find a suitable pixel format"); return GL_FALSE; - } if (!DescribePixelFormat(window->wgl.dc, pixelFormat, sizeof(pfd), &pfd)) { @@ -598,7 +606,7 @@ void _glfwPlatformSwapInterval(int interval) _GLFWwindow* window = _glfwPlatformGetCurrentContext(); #if !defined(_GLFW_USE_DWM_SWAP_INTERVAL) - if (_glfwIsCompositionEnabled()) + if (_glfwIsCompositionEnabled() && interval) { // Don't enabled vsync when desktop compositing is enabled, as it leads // to frame jitter diff --git a/extern/glfw/src/win32_init.c b/extern/glfw/src/win32_init.c index 8e0c19b..aae46a9 100644 --- a/extern/glfw/src/win32_init.c +++ b/extern/glfw/src/win32_init.c @@ -243,7 +243,7 @@ void _glfwPlatformTerminate(void) const char* _glfwPlatformGetVersionString(void) { - const char* version = _GLFW_VERSION_FULL " Win32" + const char* version = _GLFW_VERSION_NUMBER " Win32" #if defined(_GLFW_WGL) " WGL" #elif defined(_GLFW_EGL) @@ -252,7 +252,7 @@ const char* _glfwPlatformGetVersionString(void) #if defined(__MINGW32__) " MinGW" #elif defined(_MSC_VER) - " VisualC " + " VisualC" #elif defined(__BORLANDC__) " BorlandC" #endif diff --git a/extern/glfw/src/win32_joystick.c b/extern/glfw/src/win32_joystick.c index 8b67dc0..1a17236 100644 --- a/extern/glfw/src/win32_joystick.c +++ b/extern/glfw/src/win32_joystick.c @@ -97,7 +97,7 @@ const float* _glfwPlatformGetJoystickAxes(int joy, int* count) return NULL; axes[(*count)++] = calcJoystickPos(ji.dwXpos, jc.wXmin, jc.wXmax); - axes[(*count)++] = -calcJoystickPos(ji.dwYpos, jc.wYmin, jc.wYmax); + axes[(*count)++] = calcJoystickPos(ji.dwYpos, jc.wYmin, jc.wYmax); if (jc.wCaps & JOYCAPS_HASZ) axes[(*count)++] = calcJoystickPos(ji.dwZpos, jc.wZmin, jc.wZmax); @@ -109,7 +109,7 @@ const float* _glfwPlatformGetJoystickAxes(int joy, int* count) axes[(*count)++] = calcJoystickPos(ji.dwUpos, jc.wUmin, jc.wUmax); if (jc.wCaps & JOYCAPS_HASV) - axes[(*count)++] = -calcJoystickPos(ji.dwVpos, jc.wVmin, jc.wVmax); + axes[(*count)++] = calcJoystickPos(ji.dwVpos, jc.wVmin, jc.wVmax); return axes; } diff --git a/extern/glfw/src/win32_platform.h b/extern/glfw/src/win32_platform.h index e31abd9..11d774b 100644 --- a/extern/glfw/src/win32_platform.h +++ b/extern/glfw/src/win32_platform.h @@ -52,10 +52,15 @@ #define UNICODE #endif -// GLFW requires Windows XP -#ifndef WINVER +// GLFW requires Windows XP or later +#if WINVER < 0x0501 + #undef WINVER #define WINVER 0x0501 #endif +#if _WIN32_WINNT < 0x0501 + #undef _WIN32_WINNT + #define _WIN32_WINNT 0x0501 +#endif #include #include @@ -152,7 +157,7 @@ typedef struct _GLFWwindowWin32 GLboolean cursorCentered; GLboolean cursorInside; GLboolean cursorHidden; - double oldCursorX, oldCursorY; + int oldCursorX, oldCursorY; } _GLFWwindowWin32; @@ -169,8 +174,7 @@ typedef struct _GLFWlibraryWin32 struct { GLboolean hasPC; double resolution; - unsigned int t0_32; - __int64 t0_64; + unsigned __int64 base; } timer; #ifndef _GLFW_NO_DLOAD_WINMM diff --git a/extern/glfw/src/win32_time.c b/extern/glfw/src/win32_time.c index 73383d4..6c90895 100644 --- a/extern/glfw/src/win32_time.c +++ b/extern/glfw/src/win32_time.c @@ -28,6 +28,21 @@ #include "internal.h" +// Return raw time +// +static unsigned __int64 getRawTime(void) +{ + if (_glfw.win32.timer.hasPC) + { + unsigned __int64 time; + QueryPerformanceCounter((LARGE_INTEGER*) &time); + return time; + } + else + return (unsigned __int64) _glfw_timeGetTime(); +} + + ////////////////////////////////////////////////////////////////////////// ////// GLFW internal API ////// ////////////////////////////////////////////////////////////////////////// @@ -36,20 +51,20 @@ // void _glfwInitTimer(void) { - __int64 freq; + unsigned __int64 frequency; - if (QueryPerformanceFrequency((LARGE_INTEGER*) &freq)) + if (QueryPerformanceFrequency((LARGE_INTEGER*) &frequency)) { _glfw.win32.timer.hasPC = GL_TRUE; - _glfw.win32.timer.resolution = 1.0 / (double) freq; - QueryPerformanceCounter((LARGE_INTEGER*) &_glfw.win32.timer.t0_64); + _glfw.win32.timer.resolution = 1.0 / (double) frequency; } else { _glfw.win32.timer.hasPC = GL_FALSE; _glfw.win32.timer.resolution = 0.001; // winmm resolution is 1 ms - _glfw.win32.timer.t0_32 = _glfw_timeGetTime(); } + + _glfw.win32.timer.base = getRawTime(); } @@ -59,30 +74,13 @@ void _glfwInitTimer(void) double _glfwPlatformGetTime(void) { - double t; - __int64 t_64; - - if (_glfw.win32.timer.hasPC) - { - QueryPerformanceCounter((LARGE_INTEGER*) &t_64); - t = (double)(t_64 - _glfw.win32.timer.t0_64); - } - else - t = (double)(_glfw_timeGetTime() - _glfw.win32.timer.t0_32); - - return t * _glfw.win32.timer.resolution; + return (double) (getRawTime() - _glfw.win32.timer.base) * + _glfw.win32.timer.resolution; } -void _glfwPlatformSetTime(double t) +void _glfwPlatformSetTime(double time) { - __int64 t_64; - - if (_glfw.win32.timer.hasPC) - { - QueryPerformanceCounter((LARGE_INTEGER*) &t_64); - _glfw.win32.timer.t0_64 = t_64 - (__int64) (t / _glfw.win32.timer.resolution); - } - else - _glfw.win32.timer.t0_32 = _glfw_timeGetTime() - (int)(t * 1000.0); + _glfw.win32.timer.base = getRawTime() - + (unsigned __int64) (time / _glfw.win32.timer.resolution); } diff --git a/extern/glfw/src/win32_window.c b/extern/glfw/src/win32_window.c index 139e661..6803f70 100644 --- a/extern/glfw/src/win32_window.c +++ b/extern/glfw/src/win32_window.c @@ -145,7 +145,7 @@ static int translateKey(WPARAM wParam, LPARAM lParam) { // Check for numeric keypad keys // NOTE: This way we always force "NumLock = ON", which is intentional since - // the returned key code should correspond to a physical location. + // the returned key code should correspond to a physical location. if ((HIWORD(lParam) & 0x100) == 0) { switch (MapVirtualKey(HIWORD(lParam) & 0xFF, 1)) @@ -388,10 +388,21 @@ static LRESULT CALLBACK windowProc(HWND hWnd, UINT uMsg, if (focused && iconified) { - // This is a workaround for window iconification using the - // taskbar leading to windows being told they're focused and - // iconified and then never told they're defocused - focused = FALSE; + if (window->iconified && _glfw.focusedWindow != window) + { + // This is a workaround for window restoration using the + // Win+D hot key leading to windows being told they're + // focused and iconified and then never told they're + // restored + iconified = FALSE; + } + else + { + // This is a workaround for window iconification using the + // taskbar leading to windows being told they're focused and + // iconified and then never told they're defocused + focused = FALSE; + } } if (!focused && _glfw.focusedWindow == window) @@ -431,6 +442,19 @@ static LRESULT CALLBACK windowProc(HWND hWnd, UINT uMsg, return 0; } + case WM_ACTIVATEAPP: + { + if (!wParam && IsIconic(hWnd)) + { + // This is a workaround for full screen windows losing focus + // through Alt+Tab leading to windows being told they're + // unfocused and restored and then never told they're iconified + _glfwInputWindowIconify(window, GL_TRUE); + } + + return 0; + } + case WM_SHOWWINDOW: { _glfwInputWindowVisibility(window, wParam ? GL_TRUE : GL_FALSE); @@ -593,7 +617,7 @@ static LRESULT CALLBACK windowProc(HWND hWnd, UINT uMsg, if (newCursorX != window->win32.oldCursorX || newCursorY != window->win32.oldCursorY) { - double x, y; + int x, y; if (window->cursorMode == GLFW_CURSOR_DISABLED) { @@ -654,8 +678,11 @@ static LRESULT CALLBACK windowProc(HWND hWnd, UINT uMsg, case WM_SIZE: { - if (window->cursorMode == GLFW_CURSOR_DISABLED) + if (window->cursorMode == GLFW_CURSOR_DISABLED && + _glfw.focusedWindow == window) + { updateClipRect(window); + } _glfwInputFramebufferSize(window, LOWORD(lParam), HIWORD(lParam)); _glfwInputWindowSize(window, LOWORD(lParam), HIWORD(lParam)); @@ -664,10 +691,17 @@ static LRESULT CALLBACK windowProc(HWND hWnd, UINT uMsg, case WM_MOVE: { - if (window->cursorMode == GLFW_CURSOR_DISABLED) + if (window->cursorMode == GLFW_CURSOR_DISABLED && + _glfw.focusedWindow == window) + { updateClipRect(window); + } - _glfwInputWindowPos(window, LOWORD(lParam), HIWORD(lParam)); + // NOTE: This cannot use LOWORD/HIWORD recommended by MSDN, as + // those macros do not handle negative window positions correctly + _glfwInputWindowPos(window, + GET_X_LPARAM(lParam), + GET_Y_LPARAM(lParam)); return 0; } @@ -679,8 +713,8 @@ static LRESULT CALLBACK windowProc(HWND hWnd, UINT uMsg, case WM_SETCURSOR: { - if (window->cursorMode == GLFW_CURSOR_HIDDEN && - window->win32.handle == GetForegroundWindow() && + if (window->cursorMode != GLFW_CURSOR_NORMAL && + _glfw.focusedWindow == window && LOWORD(lParam) == HTCLIENT) { SetCursor(NULL); @@ -902,7 +936,7 @@ int _glfwPlatformCreateWindow(_GLFWwindow* window, // First we clear the current context (the one we just created) // This is usually done by glfwDestroyWindow, but as we're not doing - // full window destruction, it's duplicated here + // full GLFW window destruction, it's duplicated here _glfwPlatformMakeContextCurrent(NULL); // Next destroy the Win32 window and WGL context (without resetting or @@ -1000,7 +1034,7 @@ void _glfwPlatformSetWindowSize(_GLFWwindow* window, int width, int height) SetWindowPos(window->win32.handle, HWND_TOP, 0, 0, fullWidth, fullHeight, - SWP_NOOWNERZORDER | SWP_NOMOVE | SWP_NOZORDER); + SWP_NOACTIVATE | SWP_NOOWNERZORDER | SWP_NOMOVE | SWP_NOZORDER); } } @@ -1104,8 +1138,8 @@ void _glfwPlatformSetCursorPos(_GLFWwindow* window, double xpos, double ypos) ClientToScreen(window->win32.handle, &pos); SetCursorPos(pos.x, pos.y); - window->win32.oldCursorX = xpos; - window->win32.oldCursorY = ypos; + window->win32.oldCursorX = (int) xpos; + window->win32.oldCursorY = (int) ypos; } void _glfwPlatformSetCursorMode(_GLFWwindow* window, int mode) diff --git a/extern/glfw/src/window.c b/extern/glfw/src/window.c index f6bac5a..4e2b277 100644 --- a/extern/glfw/src/window.c +++ b/extern/glfw/src/window.c @@ -129,7 +129,7 @@ void _glfwInputWindowDamage(_GLFWwindow* window) void _glfwInputWindowCloseRequest(_GLFWwindow* window) { - window->closed = GL_TRUE; + window->closed = GL_TRUE; if (window->callbacks.close) window->callbacks.close((GLFWwindow*) window); @@ -213,10 +213,10 @@ GLFWAPI GLFWwindow* glfwCreateWindow(int width, int height, window->videoMode.refreshRate = Max(_glfw.hints.refreshRate, 0); } - window->monitor = wndconfig.monitor; - window->resizable = wndconfig.resizable; - window->decorated = wndconfig.decorated; - window->cursorMode = GLFW_CURSOR_NORMAL; + window->monitor = wndconfig.monitor; + window->resizable = wndconfig.resizable; + window->decorated = wndconfig.decorated; + window->cursorMode = GLFW_CURSOR_NORMAL; // Save the currently current context so it can be restored later previous = (_GLFWwindow*) glfwGetCurrentContext(); diff --git a/extern/glfw/src/x11_init.c b/extern/glfw/src/x11_init.c index 3d94ff5..5b477f0 100644 --- a/extern/glfw/src/x11_init.c +++ b/extern/glfw/src/x11_init.c @@ -409,6 +409,8 @@ static void detectEWMH(void) getSupportedAtom(supportedAtoms, atomCount, "_NET_WM_PING"); _glfw.x11.NET_ACTIVE_WINDOW = getSupportedAtom(supportedAtoms, atomCount, "_NET_ACTIVE_WINDOW"); + _glfw.x11.NET_WM_BYPASS_COMPOSITOR = + getSupportedAtom(supportedAtoms, atomCount, "_NET_WM_BYPASS_COMPOSITOR"); XFree(supportedAtoms); @@ -680,7 +682,7 @@ void _glfwPlatformTerminate(void) const char* _glfwPlatformGetVersionString(void) { - const char* version = _GLFW_VERSION_FULL " X11" + const char* version = _GLFW_VERSION_NUMBER " X11" #if defined(_GLFW_GLX) " GLX" #elif defined(_GLFW_EGL) diff --git a/extern/glfw/src/x11_joystick.c b/extern/glfw/src/x11_joystick.c index 5aaa09a..248ab12 100644 --- a/extern/glfw/src/x11_joystick.c +++ b/extern/glfw/src/x11_joystick.c @@ -125,15 +125,6 @@ static void pollJoystickEvents(void) case JS_EVENT_AXIS: _glfw.x11.joystick[i].axes[e.number] = (float) e.value / 32767.0f; - - // We need to change the sign for the Y axes, so that - // positive = up/forward, according to the GLFW spec. - if (e.number & 1) - { - _glfw.x11.joystick[i].axes[e.number] = - -_glfw.x11.joystick[i].axes[e.number]; - } - break; case JS_EVENT_BUTTON: diff --git a/extern/glfw/src/x11_monitor.c b/extern/glfw/src/x11_monitor.c index de3287c..48d47b4 100644 --- a/extern/glfw/src/x11_monitor.c +++ b/extern/glfw/src/x11_monitor.c @@ -111,6 +111,9 @@ void _glfwSetVideoMode(_GLFWmonitor* monitor, const GLFWvidmode* desired) } } + if (bestMode == ci->mode) + return; + if (monitor->x11.oldMode == None) monitor->x11.oldMode = ci->mode; diff --git a/extern/glfw/src/x11_platform.h b/extern/glfw/src/x11_platform.h index 868429f..f812938 100644 --- a/extern/glfw/src/x11_platform.h +++ b/extern/glfw/src/x11_platform.h @@ -117,6 +117,7 @@ typedef struct _GLFWlibraryX11 Atom NET_WM_PING; Atom NET_WM_STATE; Atom NET_WM_STATE_FULLSCREEN; + Atom NET_WM_BYPASS_COMPOSITOR; Atom NET_ACTIVE_WINDOW; Atom MOTIF_WM_HINTS; diff --git a/extern/glfw/src/x11_window.c b/extern/glfw/src/x11_window.c index 33c4b8e..7f75695 100644 --- a/extern/glfw/src/x11_window.c +++ b/extern/glfw/src/x11_window.c @@ -129,13 +129,15 @@ static GLboolean createWindow(_GLFWwindow* window, if (wndconfig->monitor == NULL) { // HACK: This is a workaround for windows without a background pixel - // not getting any decorations on certain older versions of Compiz - // running on Intel hardware + // not getting any decorations on certain older versions of + // Compiz running on Intel hardware wa.background_pixel = BlackPixel(_glfw.x11.display, _glfw.x11.screen); wamask |= CWBackPixel; } + _glfwGrabXErrorHandler(); + window->x11.handle = XCreateWindow(_glfw.x11.display, _glfw.x11.root, 0, 0, @@ -147,12 +149,12 @@ static GLboolean createWindow(_GLFWwindow* window, wamask, &wa); + _glfwReleaseXErrorHandler(); + if (!window->x11.handle) { - // TODO: Handle all the various error codes here and translate them - // to GLFW errors - - _glfwInputError(GLFW_PLATFORM_ERROR, "X11: Failed to create window"); + _glfwInputXError(GLFW_PLATFORM_ERROR, + "X11: Failed to create window"); return GL_FALSE; } @@ -203,13 +205,13 @@ static GLboolean createWindow(_GLFWwindow* window, // The WM_DELETE_WINDOW ICCCM protocol // Basic window close notification protocol - if (_glfw.x11.WM_DELETE_WINDOW != None) + if (_glfw.x11.WM_DELETE_WINDOW) protocols[count++] = _glfw.x11.WM_DELETE_WINDOW; // The _NET_WM_PING EWMH protocol // Tells the WM to ping the GLFW window and flag the application as // unresponsive if the WM doesn't get a reply within a few seconds - if (_glfw.x11.NET_WM_PING != None) + if (_glfw.x11.NET_WM_PING) protocols[count++] = _glfw.x11.NET_WM_PING; if (count > 0) @@ -219,7 +221,7 @@ static GLboolean createWindow(_GLFWwindow* window, } } - if (_glfw.x11.NET_WM_PID != None) + if (_glfw.x11.NET_WM_PID) { const pid_t pid = getpid(); @@ -256,6 +258,14 @@ static GLboolean createWindow(_GLFWwindow* window, hints->flags |= PPosition; _glfwPlatformGetMonitorPos(wndconfig->monitor, &hints->x, &hints->y); } + else + { + // HACK: Explicitly setting PPosition to any value causes some WMs, + // notably Compiz and Metacity, to honor the position of + // unmapped windows set by XMoveWindow + hints->flags |= PPosition; + hints->x = hints->y = 0; + } if (!wndconfig->resizable) { @@ -268,6 +278,19 @@ static GLboolean createWindow(_GLFWwindow* window, XFree(hints); } + // Set ICCCM WM_CLASS property + // HACK: Until a mechanism for specifying the application name is added, the + // initial window title is used as the window class name + if (strlen(wndconfig->title)) + { + XClassHint* hint = XAllocClassHint(); + hint->res_name = (char*) wndconfig->title; + hint->res_class = (char*) wndconfig->title; + + XSetClassHint(_glfw.x11.display, window->x11.handle, hint); + XFree(hint); + } + if (_glfw.x11.xi.available) { // Select for XInput2 events @@ -376,15 +399,22 @@ static void enterFullscreenMode(_GLFWwindow* window) _glfwSetVideoMode(window->monitor, &window->videoMode); - if (_glfw.x11.hasEWMH && - _glfw.x11.NET_WM_STATE != None && - _glfw.x11.NET_WM_STATE_FULLSCREEN != None) + if (_glfw.x11.NET_WM_BYPASS_COMPOSITOR) + { + const unsigned long value = 1; + + XChangeProperty(_glfw.x11.display, window->x11.handle, + _glfw.x11.NET_WM_BYPASS_COMPOSITOR, XA_CARDINAL, 32, + PropModeReplace, (unsigned char*) &value, 1); + } + + if (_glfw.x11.NET_WM_STATE && _glfw.x11.NET_WM_STATE_FULLSCREEN) { int x, y; _glfwPlatformGetMonitorPos(window->monitor, &x, &y); _glfwPlatformSetWindowPos(window, x, y); - if (_glfw.x11.NET_ACTIVE_WINDOW != None) + if (_glfw.x11.NET_ACTIVE_WINDOW) { // Ask the window manager to raise and focus the GLFW window // Only focused windows with the _NET_WM_STATE_FULLSCREEN state end @@ -464,9 +494,16 @@ static void leaveFullscreenMode(_GLFWwindow* window) _glfw.x11.saver.exposure); } - if (_glfw.x11.hasEWMH && - _glfw.x11.NET_WM_STATE != None && - _glfw.x11.NET_WM_STATE_FULLSCREEN != None) + if (_glfw.x11.NET_WM_BYPASS_COMPOSITOR) + { + const unsigned long value = 0; + + XChangeProperty(_glfw.x11.display, window->x11.handle, + _glfw.x11.NET_WM_BYPASS_COMPOSITOR, XA_CARDINAL, 32, + PropModeReplace, (unsigned char*) &value, 1); + } + + if (_glfw.x11.NET_WM_STATE && _glfw.x11.NET_WM_STATE_FULLSCREEN) { // Ask the window manager to make the GLFW window a normal window // Normal windows usually have frames and other decorations @@ -553,6 +590,16 @@ static void processEvent(XEvent *event) else if (event->xbutton.button == Button7) _glfwInputScroll(window, 1.0, 0.0); + else + { + // Additional buttons after 7 are treated as regular buttons + // We subtract 4 to fill the gap left by scroll input above + _glfwInputMouseClick(window, + event->xbutton.button - 4, + GLFW_PRESS, + mods); + } + break; } @@ -581,6 +628,15 @@ static void processEvent(XEvent *event) GLFW_RELEASE, mods); } + else if (event->xbutton.button > Button7) + { + // Additional buttons after 7 are treated as regular buttons + // We subtract 4 to fill the gap left by scroll input above + _glfwInputMouseClick(window, + event->xbutton.button - 4, + GLFW_RELEASE, + mods); + } break; } @@ -675,7 +731,7 @@ static void processEvent(XEvent *event) _glfwInputWindowCloseRequest(window); } - else if (_glfw.x11.NET_WM_PING != None && + else if (_glfw.x11.NET_WM_PING && (Atom) event->xclient.data.l[0] == _glfw.x11.NET_WM_PING) { // The window manager is pinging the application to ensure it's @@ -957,7 +1013,7 @@ void _glfwPlatformSetWindowTitle(_GLFWwindow* window, const char* title) NULL, NULL, NULL); #endif - if (_glfw.x11.NET_WM_NAME != None) + if (_glfw.x11.NET_WM_NAME) { XChangeProperty(_glfw.x11.display, window->x11.handle, _glfw.x11.NET_WM_NAME, _glfw.x11.UTF8_STRING, 8, @@ -965,7 +1021,7 @@ void _glfwPlatformSetWindowTitle(_GLFWwindow* window, const char* title) (unsigned char*) title, strlen(title)); } - if (_glfw.x11.NET_WM_ICON_NAME != None) + if (_glfw.x11.NET_WM_ICON_NAME) { XChangeProperty(_glfw.x11.display, window->x11.handle, _glfw.x11.NET_WM_ICON_NAME, _glfw.x11.UTF8_STRING, 8, @@ -982,7 +1038,7 @@ void _glfwPlatformGetWindowPos(_GLFWwindow* window, int* xpos, int* ypos) XTranslateCoordinates(_glfw.x11.display, window->x11.handle, _glfw.x11.root, 0, 0, &x, &y, &child); - if (child != None) + if (child) { int left, top; @@ -1063,6 +1119,9 @@ void _glfwPlatformIconifyWindow(_GLFWwindow* window) { // Override-redirect windows cannot be iconified or restored, as those // tasks are performed by the window manager + _glfwInputError(GLFW_API_UNAVAILABLE, + "X11: Iconification of full screen windows requires " + "a WM that supports EWMH"); return; } @@ -1075,6 +1134,9 @@ void _glfwPlatformRestoreWindow(_GLFWwindow* window) { // Override-redirect windows cannot be iconified or restored, as those // tasks are performed by the window manager + _glfwInputError(GLFW_API_UNAVAILABLE, + "X11: Iconification of full screen windows requires " + "a WM that supports EWMH"); return; } @@ -1116,10 +1178,8 @@ void _glfwPlatformWaitEvents(void) { if (!XPending(_glfw.x11.display)) { - int fd; fd_set fds; - - fd = ConnectionNumber(_glfw.x11.display); + const int fd = ConnectionNumber(_glfw.x11.display); FD_ZERO(&fds); FD_SET(fd, &fds); diff --git a/extern/glfw/tests/CMakeLists.txt b/extern/glfw/tests/CMakeLists.txt new file mode 100644 index 0000000..56b000a --- /dev/null +++ b/extern/glfw/tests/CMakeLists.txt @@ -0,0 +1,71 @@ + +link_libraries(glfw ${OPENGL_glu_LIBRARY}) + +if (BUILD_SHARED_LIBS) + add_definitions(-DGLFW_DLL) + link_libraries(${OPENGL_gl_LIBRARY} ${MATH_LIBRARY}) +else() + link_libraries(${glfw_LIBRARIES}) +endif() + +include_directories(${GLFW_SOURCE_DIR}/include + ${GLFW_SOURCE_DIR}/deps) + +if (NOT APPLE) + # HACK: This is NOTFOUND on OS X 10.8 + include_directories(${OPENGL_INCLUDE_DIR}) +endif() + +set(GETOPT ${GLFW_SOURCE_DIR}/deps/getopt.h + ${GLFW_SOURCE_DIR}/deps/getopt.c) +set(TINYCTHREAD ${GLFW_SOURCE_DIR}/deps/tinycthread.h + ${GLFW_SOURCE_DIR}/deps/tinycthread.c) + +add_executable(clipboard clipboard.c ${GETOPT}) +add_executable(defaults defaults.c) +add_executable(events events.c ${GETOPT}) +add_executable(fsaa fsaa.c ${GETOPT}) +add_executable(gamma gamma.c ${GETOPT}) +add_executable(glfwinfo glfwinfo.c ${GETOPT}) +add_executable(iconify iconify.c ${GETOPT}) +add_executable(joysticks joysticks.c) +add_executable(modes modes.c ${GETOPT}) +add_executable(peter peter.c) +add_executable(reopen reopen.c) + +add_executable(accuracy WIN32 MACOSX_BUNDLE accuracy.c) +set_target_properties(accuracy PROPERTIES MACOSX_BUNDLE_BUNDLE_NAME "Accuracy") + +add_executable(sharing WIN32 MACOSX_BUNDLE sharing.c) +set_target_properties(sharing PROPERTIES MACOSX_BUNDLE_BUNDLE_NAME "Sharing") + +add_executable(tearing WIN32 MACOSX_BUNDLE tearing.c) +set_target_properties(tearing PROPERTIES MACOSX_BUNDLE_BUNDLE_NAME "Tearing") + +add_executable(threads WIN32 MACOSX_BUNDLE threads.c ${TINYCTHREAD}) +set_target_properties(threads PROPERTIES MACOSX_BUNDLE_BUNDLE_NAME "Threads") + +add_executable(title WIN32 MACOSX_BUNDLE title.c) +set_target_properties(title PROPERTIES MACOSX_BUNDLE_BUNDLE_NAME "Title") + +add_executable(windows WIN32 MACOSX_BUNDLE windows.c) +set_target_properties(windows PROPERTIES MACOSX_BUNDLE_BUNDLE_NAME "Windows") + +target_link_libraries(threads ${CMAKE_THREAD_LIBS_INIT} ${RT_LIBRARY}) + +set(WINDOWS_BINARIES accuracy sharing tearing threads title windows) +set(CONSOLE_BINARIES clipboard defaults events fsaa gamma glfwinfo + iconify joysticks modes peter reopen) + +if (MSVC) + # Tell MSVC to use main instead of WinMain for Windows subsystem executables + set_target_properties(${WINDOWS_BINARIES} ${CONSOLE_BINARIES} PROPERTIES + LINK_FLAGS "/ENTRY:mainCRTStartup") +endif() + +if (APPLE) + set_target_properties(${WINDOWS_BINARIES} ${CONSOLE_BINARIES} PROPERTIES + MACOSX_BUNDLE_SHORT_VERSION_STRING ${GLFW_VERSION} + MACOSX_BUNDLE_LONG_VERSION_STRING ${GLFW_VERSION_FULL}) +endif() + diff --git a/extern/glfw/tests/accuracy.c b/extern/glfw/tests/accuracy.c new file mode 100644 index 0000000..01adbd1 --- /dev/null +++ b/extern/glfw/tests/accuracy.c @@ -0,0 +1,129 @@ +//======================================================================== +// Mouse cursor accuracy test +// Copyright (c) Camilla Berglund +// +// This software is provided 'as-is', without any express or implied +// warranty. In no event will the authors be held liable for any damages +// arising from the use of this software. +// +// Permission is granted to anyone to use this software for any purpose, +// including commercial applications, and to alter it and redistribute it +// freely, subject to the following restrictions: +// +// 1. The origin of this software must not be misrepresented; you must not +// claim that you wrote the original software. If you use this software +// in a product, an acknowledgment in the product documentation would +// be appreciated but is not required. +// +// 2. Altered source versions must be plainly marked as such, and must not +// be misrepresented as being the original software. +// +// 3. This notice may not be removed or altered from any source +// distribution. +// +//======================================================================== +// +// This test came about as the result of bug #1867804 +// +// No sign of said bug has so far been detected +// +//======================================================================== + +#define GLFW_INCLUDE_GLU +#include + +#include +#include + +static double cursor_x = 0.0, cursor_y = 0.0; +static int window_width = 640, window_height = 480; +static int swap_interval = 1; + +static void set_swap_interval(GLFWwindow* window, int interval) +{ + char title[256]; + + swap_interval = interval; + glfwSwapInterval(swap_interval); + + sprintf(title, "Cursor Inaccuracy Detector (interval %i)", swap_interval); + + glfwSetWindowTitle(window, title); +} + +static void error_callback(int error, const char* description) +{ + fprintf(stderr, "Error: %s\n", description); +} + +static void framebuffer_size_callback(GLFWwindow* window, int width, int height) +{ + window_width = width; + window_height = height; + + glViewport(0, 0, window_width, window_height); + + glMatrixMode(GL_PROJECTION); + glLoadIdentity(); + gluOrtho2D(0.f, window_width, 0.f, window_height); +} + +static void cursor_position_callback(GLFWwindow* window, double x, double y) +{ + cursor_x = x; + cursor_y = y; +} + +static void key_callback(GLFWwindow* window, int key, int scancode, int action, int mods) +{ + if (key == GLFW_KEY_SPACE && action == GLFW_PRESS) + set_swap_interval(window, 1 - swap_interval); +} + +int main(void) +{ + GLFWwindow* window; + int width, height; + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + exit(EXIT_FAILURE); + + window = glfwCreateWindow(window_width, window_height, "", NULL, NULL); + if (!window) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + glfwSetCursorPosCallback(window, cursor_position_callback); + glfwSetFramebufferSizeCallback(window, framebuffer_size_callback); + glfwSetKeyCallback(window, key_callback); + + glfwMakeContextCurrent(window); + + glfwGetFramebufferSize(window, &width, &height); + framebuffer_size_callback(window, width, height); + + set_swap_interval(window, swap_interval); + + while (!glfwWindowShouldClose(window)) + { + glClear(GL_COLOR_BUFFER_BIT); + + glBegin(GL_LINES); + glVertex2f(0.f, (GLfloat) (window_height - cursor_y)); + glVertex2f((GLfloat) window_width, (GLfloat) (window_height - cursor_y)); + glVertex2f((GLfloat) cursor_x, 0.f); + glVertex2f((GLfloat) cursor_x, (GLfloat) window_height); + glEnd(); + + glfwSwapBuffers(window); + glfwPollEvents(); + } + + glfwTerminate(); + exit(EXIT_SUCCESS); +} + diff --git a/extern/glfw/tests/clipboard.c b/extern/glfw/tests/clipboard.c new file mode 100644 index 0000000..4342284 --- /dev/null +++ b/extern/glfw/tests/clipboard.c @@ -0,0 +1,149 @@ +//======================================================================== +// Clipboard test program +// Copyright (c) Camilla Berglund +// +// This software is provided 'as-is', without any express or implied +// warranty. In no event will the authors be held liable for any damages +// arising from the use of this software. +// +// Permission is granted to anyone to use this software for any purpose, +// including commercial applications, and to alter it and redistribute it +// freely, subject to the following restrictions: +// +// 1. The origin of this software must not be misrepresented; you must not +// claim that you wrote the original software. If you use this software +// in a product, an acknowledgment in the product documentation would +// be appreciated but is not required. +// +// 2. Altered source versions must be plainly marked as such, and must not +// be misrepresented as being the original software. +// +// 3. This notice may not be removed or altered from any source +// distribution. +// +//======================================================================== +// +// This program is used to test the clipboard functionality. +// +//======================================================================== + +#include + +#include +#include + +#include "getopt.h" + +static void usage(void) +{ + printf("Usage: clipboard [-h]\n"); +} + +static void error_callback(int error, const char* description) +{ + fprintf(stderr, "Error: %s\n", description); +} + +static void key_callback(GLFWwindow* window, int key, int scancode, int action, int mods) +{ + if (action != GLFW_PRESS) + return; + + switch (key) + { + case GLFW_KEY_ESCAPE: + glfwSetWindowShouldClose(window, GL_TRUE); + break; + + case GLFW_KEY_V: + if (mods == GLFW_MOD_CONTROL) + { + const char* string; + + string = glfwGetClipboardString(window); + if (string) + printf("Clipboard contains \"%s\"\n", string); + else + printf("Clipboard does not contain a string\n"); + } + break; + + case GLFW_KEY_C: + if (mods == GLFW_MOD_CONTROL) + { + const char* string = "Hello GLFW World!"; + glfwSetClipboardString(window, string); + printf("Setting clipboard to \"%s\"\n", string); + } + break; + } +} + +static void framebuffer_size_callback(GLFWwindow* window, int width, int height) +{ + glViewport(0, 0, width, height); +} + +int main(int argc, char** argv) +{ + int ch; + GLFWwindow* window; + + while ((ch = getopt(argc, argv, "h")) != -1) + { + switch (ch) + { + case 'h': + usage(); + exit(EXIT_SUCCESS); + + default: + usage(); + exit(EXIT_FAILURE); + } + } + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + { + fprintf(stderr, "Failed to initialize GLFW\n"); + exit(EXIT_FAILURE); + } + + window = glfwCreateWindow(200, 200, "Clipboard Test", NULL, NULL); + if (!window) + { + glfwTerminate(); + + fprintf(stderr, "Failed to open GLFW window\n"); + exit(EXIT_FAILURE); + } + + glfwMakeContextCurrent(window); + glfwSwapInterval(1); + + glfwSetKeyCallback(window, key_callback); + glfwSetFramebufferSizeCallback(window, framebuffer_size_callback); + + glMatrixMode(GL_PROJECTION); + glOrtho(-1.f, 1.f, -1.f, 1.f, -1.f, 1.f); + glMatrixMode(GL_MODELVIEW); + + glClearColor(0.5f, 0.5f, 0.5f, 0); + + while (!glfwWindowShouldClose(window)) + { + glClear(GL_COLOR_BUFFER_BIT); + + glColor3f(0.8f, 0.2f, 0.4f); + glRectf(-0.5f, -0.5f, 0.5f, 0.5f); + + glfwSwapBuffers(window); + glfwWaitEvents(); + } + + glfwTerminate(); + exit(EXIT_SUCCESS); +} + diff --git a/extern/glfw/tests/defaults.c b/extern/glfw/tests/defaults.c new file mode 100644 index 0000000..2d48354 --- /dev/null +++ b/extern/glfw/tests/defaults.c @@ -0,0 +1,131 @@ +//======================================================================== +// Default window/context test +// Copyright (c) Camilla Berglund +// +// This software is provided 'as-is', without any express or implied +// warranty. In no event will the authors be held liable for any damages +// arising from the use of this software. +// +// Permission is granted to anyone to use this software for any purpose, +// including commercial applications, and to alter it and redistribute it +// freely, subject to the following restrictions: +// +// 1. The origin of this software must not be misrepresented; you must not +// claim that you wrote the original software. If you use this software +// in a product, an acknowledgment in the product documentation would +// be appreciated but is not required. +// +// 2. Altered source versions must be plainly marked as such, and must not +// be misrepresented as being the original software. +// +// 3. This notice may not be removed or altered from any source +// distribution. +// +//======================================================================== +// +// This test creates a windowed mode window with all window hints set to +// default values and then reports the actual attributes of the created +// window and context +// +//======================================================================== + +#include +#include + +#include +#include + +typedef struct +{ + int attrib; + const char* ext; + const char* name; +} AttribGL; + +typedef struct +{ + int attrib; + const char* name; +} AttribGLFW; + +static AttribGL gl_attribs[] = +{ + { GL_RED_BITS, NULL, "red bits" }, + { GL_GREEN_BITS, NULL, "green bits" }, + { GL_BLUE_BITS, NULL, "blue bits" }, + { GL_ALPHA_BITS, NULL, "alpha bits" }, + { GL_DEPTH_BITS, NULL, "depth bits" }, + { GL_STENCIL_BITS, NULL, "stencil bits" }, + { GL_STEREO, NULL, "stereo" }, + { GL_SAMPLES_ARB, "GL_ARB_multisample", "FSAA samples" }, + { 0, NULL, NULL } +}; + +static AttribGLFW glfw_attribs[] = +{ + { GLFW_CONTEXT_VERSION_MAJOR, "Context version major" }, + { GLFW_CONTEXT_VERSION_MINOR, "Context version minor" }, + { GLFW_OPENGL_FORWARD_COMPAT, "OpenGL forward compatible" }, + { GLFW_OPENGL_DEBUG_CONTEXT, "OpenGL debug context" }, + { GLFW_OPENGL_PROFILE, "OpenGL profile" }, + { 0, NULL } +}; + +static void error_callback(int error, const char* description) +{ + fprintf(stderr, "Error: %s\n", description); +} + +int main(void) +{ + int i, width, height; + GLFWwindow* window; + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + exit(EXIT_FAILURE); + + glfwWindowHint(GLFW_VISIBLE, GL_FALSE); + + window = glfwCreateWindow(640, 480, "Defaults", NULL, NULL); + if (!window) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + glfwMakeContextCurrent(window); + glfwGetFramebufferSize(window, &width, &height); + + printf("framebuffer size: %ix%i\n", width, height); + + for (i = 0; glfw_attribs[i].name; i++) + { + printf("%s: %i\n", + glfw_attribs[i].name, + glfwGetWindowAttrib(window, glfw_attribs[i].attrib)); + } + + for (i = 0; gl_attribs[i].name; i++) + { + GLint value = 0; + + if (gl_attribs[i].ext) + { + if (!glfwExtensionSupported(gl_attribs[i].ext)) + continue; + } + + glGetIntegerv(gl_attribs[i].attrib, &value); + + printf("%s: %i\n", gl_attribs[i].name, value); + } + + glfwDestroyWindow(window); + window = NULL; + + glfwTerminate(); + exit(EXIT_SUCCESS); +} + diff --git a/extern/glfw/tests/events.c b/extern/glfw/tests/events.c new file mode 100644 index 0000000..7ac69c8 --- /dev/null +++ b/extern/glfw/tests/events.c @@ -0,0 +1,480 @@ +//======================================================================== +// Event linter (event spewer) +// Copyright (c) Camilla Berglund +// +// This software is provided 'as-is', without any express or implied +// warranty. In no event will the authors be held liable for any damages +// arising from the use of this software. +// +// Permission is granted to anyone to use this software for any purpose, +// including commercial applications, and to alter it and redistribute it +// freely, subject to the following restrictions: +// +// 1. The origin of this software must not be misrepresented; you must not +// claim that you wrote the original software. If you use this software +// in a product, an acknowledgment in the product documentation would +// be appreciated but is not required. +// +// 2. Altered source versions must be plainly marked as such, and must not +// be misrepresented as being the original software. +// +// 3. This notice may not be removed or altered from any source +// distribution. +// +//======================================================================== +// +// This test hooks every available callback and outputs their arguments +// +// Log messages go to stdout, error messages to stderr +// +// Every event also gets a (sequential) number to aid discussion of logs +// +//======================================================================== + +#include + +#include +#include +#include +#include +#include + +#include "getopt.h" + +// These must match the input mode defaults +static GLboolean closeable = GL_TRUE; + +// Event index +static unsigned int counter = 0; + +static const char* get_key_name(int key) +{ + switch (key) + { + // Printable keys + case GLFW_KEY_A: return "A"; + case GLFW_KEY_B: return "B"; + case GLFW_KEY_C: return "C"; + case GLFW_KEY_D: return "D"; + case GLFW_KEY_E: return "E"; + case GLFW_KEY_F: return "F"; + case GLFW_KEY_G: return "G"; + case GLFW_KEY_H: return "H"; + case GLFW_KEY_I: return "I"; + case GLFW_KEY_J: return "J"; + case GLFW_KEY_K: return "K"; + case GLFW_KEY_L: return "L"; + case GLFW_KEY_M: return "M"; + case GLFW_KEY_N: return "N"; + case GLFW_KEY_O: return "O"; + case GLFW_KEY_P: return "P"; + case GLFW_KEY_Q: return "Q"; + case GLFW_KEY_R: return "R"; + case GLFW_KEY_S: return "S"; + case GLFW_KEY_T: return "T"; + case GLFW_KEY_U: return "U"; + case GLFW_KEY_V: return "V"; + case GLFW_KEY_W: return "W"; + case GLFW_KEY_X: return "X"; + case GLFW_KEY_Y: return "Y"; + case GLFW_KEY_Z: return "Z"; + case GLFW_KEY_1: return "1"; + case GLFW_KEY_2: return "2"; + case GLFW_KEY_3: return "3"; + case GLFW_KEY_4: return "4"; + case GLFW_KEY_5: return "5"; + case GLFW_KEY_6: return "6"; + case GLFW_KEY_7: return "7"; + case GLFW_KEY_8: return "8"; + case GLFW_KEY_9: return "9"; + case GLFW_KEY_0: return "0"; + case GLFW_KEY_SPACE: return "SPACE"; + case GLFW_KEY_MINUS: return "MINUS"; + case GLFW_KEY_EQUAL: return "EQUAL"; + case GLFW_KEY_LEFT_BRACKET: return "LEFT BRACKET"; + case GLFW_KEY_RIGHT_BRACKET: return "RIGHT BRACKET"; + case GLFW_KEY_BACKSLASH: return "BACKSLASH"; + case GLFW_KEY_SEMICOLON: return "SEMICOLON"; + case GLFW_KEY_APOSTROPHE: return "APOSTROPHE"; + case GLFW_KEY_GRAVE_ACCENT: return "GRAVE ACCENT"; + case GLFW_KEY_COMMA: return "COMMA"; + case GLFW_KEY_PERIOD: return "PERIOD"; + case GLFW_KEY_SLASH: return "SLASH"; + case GLFW_KEY_WORLD_1: return "WORLD 1"; + case GLFW_KEY_WORLD_2: return "WORLD 2"; + + // Function keys + case GLFW_KEY_ESCAPE: return "ESCAPE"; + case GLFW_KEY_F1: return "F1"; + case GLFW_KEY_F2: return "F2"; + case GLFW_KEY_F3: return "F3"; + case GLFW_KEY_F4: return "F4"; + case GLFW_KEY_F5: return "F5"; + case GLFW_KEY_F6: return "F6"; + case GLFW_KEY_F7: return "F7"; + case GLFW_KEY_F8: return "F8"; + case GLFW_KEY_F9: return "F9"; + case GLFW_KEY_F10: return "F10"; + case GLFW_KEY_F11: return "F11"; + case GLFW_KEY_F12: return "F12"; + case GLFW_KEY_F13: return "F13"; + case GLFW_KEY_F14: return "F14"; + case GLFW_KEY_F15: return "F15"; + case GLFW_KEY_F16: return "F16"; + case GLFW_KEY_F17: return "F17"; + case GLFW_KEY_F18: return "F18"; + case GLFW_KEY_F19: return "F19"; + case GLFW_KEY_F20: return "F20"; + case GLFW_KEY_F21: return "F21"; + case GLFW_KEY_F22: return "F22"; + case GLFW_KEY_F23: return "F23"; + case GLFW_KEY_F24: return "F24"; + case GLFW_KEY_F25: return "F25"; + case GLFW_KEY_UP: return "UP"; + case GLFW_KEY_DOWN: return "DOWN"; + case GLFW_KEY_LEFT: return "LEFT"; + case GLFW_KEY_RIGHT: return "RIGHT"; + case GLFW_KEY_LEFT_SHIFT: return "LEFT SHIFT"; + case GLFW_KEY_RIGHT_SHIFT: return "RIGHT SHIFT"; + case GLFW_KEY_LEFT_CONTROL: return "LEFT CONTROL"; + case GLFW_KEY_RIGHT_CONTROL: return "RIGHT CONTROL"; + case GLFW_KEY_LEFT_ALT: return "LEFT ALT"; + case GLFW_KEY_RIGHT_ALT: return "RIGHT ALT"; + case GLFW_KEY_TAB: return "TAB"; + case GLFW_KEY_ENTER: return "ENTER"; + case GLFW_KEY_BACKSPACE: return "BACKSPACE"; + case GLFW_KEY_INSERT: return "INSERT"; + case GLFW_KEY_DELETE: return "DELETE"; + case GLFW_KEY_PAGE_UP: return "PAGE UP"; + case GLFW_KEY_PAGE_DOWN: return "PAGE DOWN"; + case GLFW_KEY_HOME: return "HOME"; + case GLFW_KEY_END: return "END"; + case GLFW_KEY_KP_0: return "KEYPAD 0"; + case GLFW_KEY_KP_1: return "KEYPAD 1"; + case GLFW_KEY_KP_2: return "KEYPAD 2"; + case GLFW_KEY_KP_3: return "KEYPAD 3"; + case GLFW_KEY_KP_4: return "KEYPAD 4"; + case GLFW_KEY_KP_5: return "KEYPAD 5"; + case GLFW_KEY_KP_6: return "KEYPAD 6"; + case GLFW_KEY_KP_7: return "KEYPAD 7"; + case GLFW_KEY_KP_8: return "KEYPAD 8"; + case GLFW_KEY_KP_9: return "KEYPAD 9"; + case GLFW_KEY_KP_DIVIDE: return "KEYPAD DIVIDE"; + case GLFW_KEY_KP_MULTIPLY: return "KEYPAD MULTPLY"; + case GLFW_KEY_KP_SUBTRACT: return "KEYPAD SUBTRACT"; + case GLFW_KEY_KP_ADD: return "KEYPAD ADD"; + case GLFW_KEY_KP_DECIMAL: return "KEYPAD DECIMAL"; + case GLFW_KEY_KP_EQUAL: return "KEYPAD EQUAL"; + case GLFW_KEY_KP_ENTER: return "KEYPAD ENTER"; + case GLFW_KEY_PRINT_SCREEN: return "PRINT SCREEN"; + case GLFW_KEY_NUM_LOCK: return "NUM LOCK"; + case GLFW_KEY_CAPS_LOCK: return "CAPS LOCK"; + case GLFW_KEY_SCROLL_LOCK: return "SCROLL LOCK"; + case GLFW_KEY_PAUSE: return "PAUSE"; + case GLFW_KEY_LEFT_SUPER: return "LEFT SUPER"; + case GLFW_KEY_RIGHT_SUPER: return "RIGHT SUPER"; + case GLFW_KEY_MENU: return "MENU"; + case GLFW_KEY_UNKNOWN: return "UNKNOWN"; + + default: return NULL; + } +} + +static const char* get_action_name(int action) +{ + switch (action) + { + case GLFW_PRESS: + return "pressed"; + case GLFW_RELEASE: + return "released"; + case GLFW_REPEAT: + return "repeated"; + } + + return "caused unknown action"; +} + +static const char* get_button_name(int button) +{ + switch (button) + { + case GLFW_MOUSE_BUTTON_LEFT: + return "left"; + case GLFW_MOUSE_BUTTON_RIGHT: + return "right"; + case GLFW_MOUSE_BUTTON_MIDDLE: + return "middle"; + } + + return NULL; +} + +static const char* get_mods_name(int mods) +{ + static char name[512]; + + name[0] = '\0'; + + if (mods & GLFW_MOD_SHIFT) + strcat(name, " shift"); + if (mods & GLFW_MOD_CONTROL) + strcat(name, " control"); + if (mods & GLFW_MOD_ALT) + strcat(name, " alt"); + if (mods & GLFW_MOD_SUPER) + strcat(name, " super"); + + return name; +} + +static const char* get_character_string(int codepoint) +{ + // This assumes UTF-8, which is stupid + static char result[6 + 1]; + + int length = wctomb(result, codepoint); + if (length == -1) + length = 0; + + result[length] = '\0'; + return result; +} + +static void error_callback(int error, const char* description) +{ + fprintf(stderr, "Error: %s\n", description); +} + +static void window_pos_callback(GLFWwindow* window, int x, int y) +{ + printf("%08x at %0.3f: Window position: %i %i\n", + counter++, + glfwGetTime(), + x, + y); +} + +static void window_size_callback(GLFWwindow* window, int width, int height) +{ + printf("%08x at %0.3f: Window size: %i %i\n", + counter++, + glfwGetTime(), + width, + height); +} + +static void framebuffer_size_callback(GLFWwindow* window, int width, int height) +{ + printf("%08x at %0.3f: Framebuffer size: %i %i\n", + counter++, + glfwGetTime(), + width, + height); + + glViewport(0, 0, width, height); +} + +static void window_close_callback(GLFWwindow* window) +{ + printf("%08x at %0.3f: Window close\n", counter++, glfwGetTime()); + + glfwSetWindowShouldClose(window, closeable); +} + +static void window_refresh_callback(GLFWwindow* window) +{ + printf("%08x at %0.3f: Window refresh\n", counter++, glfwGetTime()); + + if (glfwGetCurrentContext()) + { + glClear(GL_COLOR_BUFFER_BIT); + glfwSwapBuffers(window); + } +} + +static void window_focus_callback(GLFWwindow* window, int focused) +{ + printf("%08x at %0.3f: Window %s\n", + counter++, + glfwGetTime(), + focused ? "focused" : "defocused"); +} + +static void window_iconify_callback(GLFWwindow* window, int iconified) +{ + printf("%08x at %0.3f: Window was %s\n", + counter++, + glfwGetTime(), + iconified ? "iconified" : "restored"); +} + +static void mouse_button_callback(GLFWwindow* window, int button, int action, int mods) +{ + const char* name = get_button_name(button); + + printf("%08x at %0.3f: Mouse button %i", counter++, glfwGetTime(), button); + + if (name) + printf(" (%s)", name); + + if (mods) + printf(" (with%s)", get_mods_name(mods)); + + printf(" was %s\n", get_action_name(action)); +} + +static void cursor_position_callback(GLFWwindow* window, double x, double y) +{ + printf("%08x at %0.3f: Cursor position: %f %f\n", counter++, glfwGetTime(), x, y); +} + +static void cursor_enter_callback(GLFWwindow* window, int entered) +{ + printf("%08x at %0.3f: Cursor %s window\n", + counter++, + glfwGetTime(), + entered ? "entered" : "left"); +} + +static void scroll_callback(GLFWwindow* window, double x, double y) +{ + printf("%08x at %0.3f: Scroll: %0.3f %0.3f\n", counter++, glfwGetTime(), x, y); +} + +static void key_callback(GLFWwindow* window, int key, int scancode, int action, int mods) +{ + const char* name = get_key_name(key); + + printf("%08x at %0.3f: Key 0x%04x Scancode 0x%04x", + counter++, glfwGetTime(), key, scancode); + + if (name) + printf(" (%s)", name); + + if (mods) + printf(" (with%s)", get_mods_name(mods)); + + printf(" was %s\n", get_action_name(action)); + + if (action != GLFW_PRESS) + return; + + switch (key) + { + case GLFW_KEY_C: + { + closeable = !closeable; + + printf("(( closing %s ))\n", closeable ? "enabled" : "disabled"); + break; + } + } +} + +static void char_callback(GLFWwindow* window, unsigned int codepoint) +{ + printf("%08x at %0.3f: Character 0x%08x (%s) input\n", + counter++, + glfwGetTime(), + codepoint, + get_character_string(codepoint)); +} + +void monitor_callback(GLFWmonitor* monitor, int event) +{ + if (event == GLFW_CONNECTED) + { + int x, y, widthMM, heightMM; + const GLFWvidmode* mode = glfwGetVideoMode(monitor); + + glfwGetMonitorPos(monitor, &x, &y); + glfwGetMonitorPhysicalSize(monitor, &widthMM, &heightMM); + + printf("%08x at %0.3f: Monitor %s (%ix%i at %ix%i, %ix%i mm) was connected\n", + counter++, + glfwGetTime(), + glfwGetMonitorName(monitor), + mode->width, mode->height, + x, y, + widthMM, heightMM); + } + else + { + printf("%08x at %0.3f: Monitor %s was disconnected\n", + counter++, + glfwGetTime(), + glfwGetMonitorName(monitor)); + } +} + +int main(int argc, char** argv) +{ + GLFWwindow* window; + GLFWmonitor* monitor = NULL; + int ch, width, height; + + setlocale(LC_ALL, ""); + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + exit(EXIT_FAILURE); + + printf("Library initialized\n"); + + while ((ch = getopt(argc, argv, "f")) != -1) + { + switch (ch) + { + case 'f': + monitor = glfwGetPrimaryMonitor(); + break; + } + } + + window = glfwCreateWindow(640, 480, "Event Linter", monitor, NULL); + if (!window) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + printf("Window opened\n"); + + glfwSetMonitorCallback(monitor_callback); + + glfwSetWindowPosCallback(window, window_pos_callback); + glfwSetWindowSizeCallback(window, window_size_callback); + glfwSetFramebufferSizeCallback(window, framebuffer_size_callback); + glfwSetWindowCloseCallback(window, window_close_callback); + glfwSetWindowRefreshCallback(window, window_refresh_callback); + glfwSetWindowFocusCallback(window, window_focus_callback); + glfwSetWindowIconifyCallback(window, window_iconify_callback); + glfwSetMouseButtonCallback(window, mouse_button_callback); + glfwSetCursorPosCallback(window, cursor_position_callback); + glfwSetCursorEnterCallback(window, cursor_enter_callback); + glfwSetScrollCallback(window, scroll_callback); + glfwSetKeyCallback(window, key_callback); + glfwSetCharCallback(window, char_callback); + + glfwMakeContextCurrent(window); + glfwSwapInterval(1); + + glfwGetWindowSize(window, &width, &height); + printf("Window size should be %ix%i\n", width, height); + + printf("Main loop starting\n"); + + while (!glfwWindowShouldClose(window)) + { + glfwWaitEvents(); + + // Workaround for an issue with msvcrt and mintty + fflush(stdout); + } + + glfwTerminate(); + exit(EXIT_SUCCESS); +} + diff --git a/extern/glfw/tests/fsaa.c b/extern/glfw/tests/fsaa.c new file mode 100644 index 0000000..1725825 --- /dev/null +++ b/extern/glfw/tests/fsaa.c @@ -0,0 +1,158 @@ +//======================================================================== +// Fullscreen anti-aliasing test +// Copyright (c) Camilla Berglund +// +// This software is provided 'as-is', without any express or implied +// warranty. In no event will the authors be held liable for any damages +// arising from the use of this software. +// +// Permission is granted to anyone to use this software for any purpose, +// including commercial applications, and to alter it and redistribute it +// freely, subject to the following restrictions: +// +// 1. The origin of this software must not be misrepresented; you must not +// claim that you wrote the original software. If you use this software +// in a product, an acknowledgment in the product documentation would +// be appreciated but is not required. +// +// 2. Altered source versions must be plainly marked as such, and must not +// be misrepresented as being the original software. +// +// 3. This notice may not be removed or altered from any source +// distribution. +// +//======================================================================== +// +// This test renders two high contrast, slowly rotating quads, one aliased +// and one (hopefully) anti-aliased, thus allowing for visual verification +// of whether FSAA is indeed enabled +// +//======================================================================== + +#define GLFW_INCLUDE_GLU +#include +#include + +#include +#include + +#include "getopt.h" + +static void error_callback(int error, const char* description) +{ + fprintf(stderr, "Error: %s\n", description); +} + +static void framebuffer_size_callback(GLFWwindow* window, int width, int height) +{ + glViewport(0, 0, width, height); +} + +static void key_callback(GLFWwindow* window, int key, int scancode, int action, int mods) +{ + if (action != GLFW_PRESS) + return; + + switch (key) + { + case GLFW_KEY_SPACE: + glfwSetTime(0.0); + break; + } +} + +static void usage(void) +{ + printf("Usage: fsaa [-h] [-s SAMPLES]\n"); +} + +int main(int argc, char** argv) +{ + int ch, samples = 4; + GLFWwindow* window; + + while ((ch = getopt(argc, argv, "hs:")) != -1) + { + switch (ch) + { + case 'h': + usage(); + exit(EXIT_SUCCESS); + case 's': + samples = atoi(optarg); + break; + default: + usage(); + exit(EXIT_FAILURE); + } + } + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + exit(EXIT_FAILURE); + + if (samples) + printf("Requesting FSAA with %i samples\n", samples); + else + printf("Requesting that FSAA not be available\n"); + + glfwWindowHint(GLFW_SAMPLES, samples); + + window = glfwCreateWindow(800, 400, "Aliasing Detector", NULL, NULL); + if (!window) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + glfwSetKeyCallback(window, key_callback); + glfwSetFramebufferSizeCallback(window, framebuffer_size_callback); + + glfwMakeContextCurrent(window); + glfwSwapInterval(1); + + if (!glfwExtensionSupported("GL_ARB_multisample")) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + glGetIntegerv(GL_SAMPLES_ARB, &samples); + if (samples) + printf("Context reports FSAA is available with %i samples\n", samples); + else + printf("Context reports FSAA is unavailable\n"); + + glMatrixMode(GL_PROJECTION); + gluOrtho2D(0.f, 1.f, 0.f, 0.5f); + glMatrixMode(GL_MODELVIEW); + + while (!glfwWindowShouldClose(window)) + { + GLfloat time = (GLfloat) glfwGetTime(); + + glClear(GL_COLOR_BUFFER_BIT); + + glLoadIdentity(); + glTranslatef(0.25f, 0.25f, 0.f); + glRotatef(time, 0.f, 0.f, 1.f); + + glDisable(GL_MULTISAMPLE_ARB); + glRectf(-0.15f, -0.15f, 0.15f, 0.15f); + + glLoadIdentity(); + glTranslatef(0.75f, 0.25f, 0.f); + glRotatef(time, 0.f, 0.f, 1.f); + + glEnable(GL_MULTISAMPLE_ARB); + glRectf(-0.15f, -0.15f, 0.15f, 0.15f); + + glfwSwapBuffers(window); + glfwPollEvents(); + } + + glfwTerminate(); + exit(EXIT_SUCCESS); +} + diff --git a/extern/glfw/tests/gamma.c b/extern/glfw/tests/gamma.c new file mode 100644 index 0000000..19dc35d --- /dev/null +++ b/extern/glfw/tests/gamma.c @@ -0,0 +1,175 @@ +//======================================================================== +// Gamma correction test program +// Copyright (c) Camilla Berglund +// +// This software is provided 'as-is', without any express or implied +// warranty. In no event will the authors be held liable for any damages +// arising from the use of this software. +// +// Permission is granted to anyone to use this software for any purpose, +// including commercial applications, and to alter it and redistribute it +// freely, subject to the following restrictions: +// +// 1. The origin of this software must not be misrepresented; you must not +// claim that you wrote the original software. If you use this software +// in a product, an acknowledgment in the product documentation would +// be appreciated but is not required. +// +// 2. Altered source versions must be plainly marked as such, and must not +// be misrepresented as being the original software. +// +// 3. This notice may not be removed or altered from any source +// distribution. +// +//======================================================================== +// +// This program is used to test the gamma correction functionality for +// both fullscreen and windowed mode windows +// +//======================================================================== + +#include + +#include +#include + +#include "getopt.h" + +#define STEP_SIZE 0.1f + +static GLfloat gamma_value = 1.0f; + +static void usage(void) +{ + printf("Usage: gamma [-h] [-f]\n"); +} + +static void set_gamma(GLFWwindow* window, float value) +{ + GLFWmonitor* monitor = glfwGetWindowMonitor(window); + if (!monitor) + monitor = glfwGetPrimaryMonitor(); + + gamma_value = value; + printf("Gamma: %f\n", gamma_value); + glfwSetGamma(monitor, gamma_value); +} + +static void error_callback(int error, const char* description) +{ + fprintf(stderr, "Error: %s\n", description); +} + +static void key_callback(GLFWwindow* window, int key, int scancode, int action, int mods) +{ + if (action != GLFW_PRESS) + return; + + switch (key) + { + case GLFW_KEY_ESCAPE: + { + glfwSetWindowShouldClose(window, GL_TRUE); + break; + } + + case GLFW_KEY_KP_ADD: + case GLFW_KEY_Q: + { + set_gamma(window, gamma_value + STEP_SIZE); + break; + } + + case GLFW_KEY_KP_SUBTRACT: + case GLFW_KEY_W: + { + if (gamma_value - STEP_SIZE > 0.f) + set_gamma(window, gamma_value - STEP_SIZE); + + break; + } + } +} + +static void framebuffer_size_callback(GLFWwindow* window, int width, int height) +{ + glViewport(0, 0, width, height); +} + +int main(int argc, char** argv) +{ + int width, height, ch; + GLFWmonitor* monitor = NULL; + GLFWwindow* window; + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + exit(EXIT_FAILURE); + + while ((ch = getopt(argc, argv, "fh")) != -1) + { + switch (ch) + { + case 'h': + usage(); + exit(EXIT_SUCCESS); + + case 'f': + monitor = glfwGetPrimaryMonitor(); + break; + + default: + usage(); + exit(EXIT_FAILURE); + } + } + + if (monitor) + { + const GLFWvidmode* mode = glfwGetVideoMode(monitor); + width = mode->width; + height = mode->height; + } + else + { + width = 200; + height = 200; + } + + window = glfwCreateWindow(width, height, "Gamma Test", monitor, NULL); + if (!window) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + set_gamma(window, 1.f); + + glfwMakeContextCurrent(window); + glfwSwapInterval(1); + + glfwSetKeyCallback(window, key_callback); + glfwSetFramebufferSizeCallback(window, framebuffer_size_callback); + + glMatrixMode(GL_PROJECTION); + glOrtho(-1.f, 1.f, -1.f, 1.f, -1.f, 1.f); + glMatrixMode(GL_MODELVIEW); + + glClearColor(0.5f, 0.5f, 0.5f, 0); + + while (!glfwWindowShouldClose(window)) + { + glClear(GL_COLOR_BUFFER_BIT); + + glColor3f(0.8f, 0.2f, 0.4f); + glRectf(-0.5f, -0.5f, 0.5f, 0.5f); + + glfwSwapBuffers(window); + glfwWaitEvents(); + } + + glfwTerminate(); + exit(EXIT_SUCCESS); +} + diff --git a/extern/glfw/tests/glfwinfo.c b/extern/glfw/tests/glfwinfo.c new file mode 100644 index 0000000..fc312de --- /dev/null +++ b/extern/glfw/tests/glfwinfo.c @@ -0,0 +1,396 @@ +//======================================================================== +// Version information dumper +// Copyright (c) Camilla Berglund +// +// This software is provided 'as-is', without any express or implied +// warranty. In no event will the authors be held liable for any damages +// arising from the use of this software. +// +// Permission is granted to anyone to use this software for any purpose, +// including commercial applications, and to alter it and redistribute it +// freely, subject to the following restrictions: +// +// 1. The origin of this software must not be misrepresented; you must not +// claim that you wrote the original software. If you use this software +// in a product, an acknowledgment in the product documentation would +// be appreciated but is not required. +// +// 2. Altered source versions must be plainly marked as such, and must not +// be misrepresented as being the original software. +// +// 3. This notice may not be removed or altered from any source +// distribution. +// +//======================================================================== +// +// This test is a pale imitation of glxinfo(1), except not really +// +// It dumps GLFW and OpenGL version information +// +//======================================================================== + +#include +#include + +#include +#include +#include + +#include "getopt.h" + +#ifdef _MSC_VER +#define strcasecmp(x, y) _stricmp(x, y) +#endif + +#define API_OPENGL "gl" +#define API_OPENGL_ES "es" + +#define PROFILE_NAME_CORE "core" +#define PROFILE_NAME_COMPAT "compat" + +#define STRATEGY_NAME_NONE "none" +#define STRATEGY_NAME_LOSE "lose" + +static void usage(void) +{ + printf("Usage: glfwinfo [-h] [-a API] [-m MAJOR] [-n MINOR] [-d] [-l] [-f] [-p PROFILE] [-r STRATEGY]\n"); + printf("Options:\n"); + printf(" -a the client API to use (" API_OPENGL " or " API_OPENGL_ES ")\n"); + printf(" -d request a debug context\n"); + printf(" -f require a forward-compatible context\n"); + printf(" -h show this help\n"); + printf(" -l list all client API extensions after context creation\n"); + printf(" -m the major number of the requred client API version\n"); + printf(" -n the minor number of the requred client API version\n"); + printf(" -p the OpenGL profile to use (" PROFILE_NAME_CORE " or " PROFILE_NAME_COMPAT ")\n"); + printf(" -r the robustness strategy to use (" STRATEGY_NAME_NONE " or " STRATEGY_NAME_LOSE ")\n"); +} + +static void error_callback(int error, const char* description) +{ + fprintf(stderr, "Error: %s\n", description); +} + +static const char* get_client_api_name(int api) +{ + if (api == GLFW_OPENGL_API) + return "OpenGL"; + else if (api == GLFW_OPENGL_ES_API) + return "OpenGL ES"; + + return "Unknown API"; +} + +static const char* get_profile_name_gl(GLint mask) +{ + if (mask & GL_CONTEXT_COMPATIBILITY_PROFILE_BIT) + return PROFILE_NAME_COMPAT; + if (mask & GL_CONTEXT_CORE_PROFILE_BIT) + return PROFILE_NAME_CORE; + + return "unknown"; +} + +static const char* get_profile_name_glfw(int profile) +{ + if (profile == GLFW_OPENGL_COMPAT_PROFILE) + return PROFILE_NAME_COMPAT; + if (profile == GLFW_OPENGL_CORE_PROFILE) + return PROFILE_NAME_CORE; + + return "unknown"; +} + +static const char* get_strategy_name_gl(GLint strategy) +{ + if (strategy == GL_LOSE_CONTEXT_ON_RESET_ARB) + return STRATEGY_NAME_LOSE; + if (strategy == GL_NO_RESET_NOTIFICATION_ARB) + return STRATEGY_NAME_NONE; + + return "unknown"; +} + +static const char* get_strategy_name_glfw(int strategy) +{ + if (strategy == GLFW_LOSE_CONTEXT_ON_RESET) + return STRATEGY_NAME_LOSE; + if (strategy == GLFW_NO_RESET_NOTIFICATION) + return STRATEGY_NAME_NONE; + + return "unknown"; +} + +static void list_extensions(int api, int major, int minor) +{ + int i; + GLint count; + const GLubyte* extensions; + + printf("%s context supported extensions:\n", get_client_api_name(api)); + + if (api == GLFW_OPENGL_API && major > 2) + { + PFNGLGETSTRINGIPROC glGetStringi = (PFNGLGETSTRINGIPROC) glfwGetProcAddress("glGetStringi"); + if (!glGetStringi) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + glGetIntegerv(GL_NUM_EXTENSIONS, &count); + + for (i = 0; i < count; i++) + puts((const char*) glGetStringi(GL_EXTENSIONS, i)); + } + else + { + extensions = glGetString(GL_EXTENSIONS); + while (*extensions != '\0') + { + if (*extensions == ' ') + putchar('\n'); + else + putchar(*extensions); + + extensions++; + } + } + + putchar('\n'); +} + +static GLboolean valid_version(void) +{ + int major, minor, revision; + + glfwGetVersion(&major, &minor, &revision); + + printf("GLFW header version: %u.%u.%u\n", + GLFW_VERSION_MAJOR, + GLFW_VERSION_MINOR, + GLFW_VERSION_REVISION); + + printf("GLFW library version: %u.%u.%u\n", major, minor, revision); + + if (major != GLFW_VERSION_MAJOR) + { + printf("*** ERROR: GLFW major version mismatch! ***\n"); + return GL_FALSE; + } + + if (minor != GLFW_VERSION_MINOR || revision != GLFW_VERSION_REVISION) + printf("*** WARNING: GLFW version mismatch! ***\n"); + + printf("GLFW library version string: \"%s\"\n", glfwGetVersionString()); + return GL_TRUE; +} + +int main(int argc, char** argv) +{ + int ch, api = 0, profile = 0, strategy = 0, major = 1, minor = 0, revision; + GLboolean debug = GL_FALSE, forward = GL_FALSE, list = GL_FALSE; + GLint flags, mask; + GLFWwindow* window; + + while ((ch = getopt(argc, argv, "a:dfhlm:n:p:r:")) != -1) + { + switch (ch) + { + case 'a': + if (strcasecmp(optarg, API_OPENGL) == 0) + api = GLFW_OPENGL_API; + else if (strcasecmp(optarg, API_OPENGL_ES) == 0) + api = GLFW_OPENGL_ES_API; + else + { + usage(); + exit(EXIT_FAILURE); + } + case 'd': + debug = GL_TRUE; + break; + case 'f': + forward = GL_TRUE; + break; + case 'h': + usage(); + exit(EXIT_SUCCESS); + case 'l': + list = GL_TRUE; + break; + case 'm': + major = atoi(optarg); + break; + case 'n': + minor = atoi(optarg); + break; + case 'p': + if (strcasecmp(optarg, PROFILE_NAME_CORE) == 0) + profile = GLFW_OPENGL_CORE_PROFILE; + else if (strcasecmp(optarg, PROFILE_NAME_COMPAT) == 0) + profile = GLFW_OPENGL_COMPAT_PROFILE; + else + { + usage(); + exit(EXIT_FAILURE); + } + break; + case 'r': + if (strcasecmp(optarg, STRATEGY_NAME_NONE) == 0) + strategy = GLFW_NO_RESET_NOTIFICATION; + else if (strcasecmp(optarg, STRATEGY_NAME_LOSE) == 0) + strategy = GLFW_LOSE_CONTEXT_ON_RESET; + else + { + usage(); + exit(EXIT_FAILURE); + } + break; + default: + usage(); + exit(EXIT_FAILURE); + } + } + + // Initialize GLFW and create window + + if (!valid_version()) + exit(EXIT_FAILURE); + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + exit(EXIT_FAILURE); + + if (major != 1 || minor != 0) + { + glfwWindowHint(GLFW_CONTEXT_VERSION_MAJOR, major); + glfwWindowHint(GLFW_CONTEXT_VERSION_MINOR, minor); + } + + if (api != 0) + glfwWindowHint(GLFW_CLIENT_API, api); + + if (debug) + glfwWindowHint(GLFW_OPENGL_DEBUG_CONTEXT, GL_TRUE); + + if (forward) + glfwWindowHint(GLFW_OPENGL_FORWARD_COMPAT, GL_TRUE); + + if (profile != 0) + glfwWindowHint(GLFW_OPENGL_PROFILE, profile); + + if (strategy) + glfwWindowHint(GLFW_CONTEXT_ROBUSTNESS, strategy); + + glfwWindowHint(GLFW_VISIBLE, GL_FALSE); + + window = glfwCreateWindow(200, 200, "Version", NULL, NULL); + if (!window) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + glfwMakeContextCurrent(window); + + // Report client API version + + api = glfwGetWindowAttrib(window, GLFW_CLIENT_API); + major = glfwGetWindowAttrib(window, GLFW_CONTEXT_VERSION_MAJOR); + minor = glfwGetWindowAttrib(window, GLFW_CONTEXT_VERSION_MINOR); + revision = glfwGetWindowAttrib(window, GLFW_CONTEXT_REVISION); + + printf("%s context version string: \"%s\"\n", + get_client_api_name(api), + glGetString(GL_VERSION)); + + printf("%s context version parsed by GLFW: %u.%u.%u\n", + get_client_api_name(api), + major, minor, revision); + + // Report client API context properties + + if (api == GLFW_OPENGL_API) + { + if (major >= 3) + { + glGetIntegerv(GL_CONTEXT_FLAGS, &flags); + printf("%s context flags (0x%08x):", get_client_api_name(api), flags); + + if (flags & GL_CONTEXT_FLAG_FORWARD_COMPATIBLE_BIT) + printf(" forward-compatible"); + if (flags & GL_CONTEXT_FLAG_DEBUG_BIT) + printf(" debug"); + if (flags & GL_CONTEXT_FLAG_ROBUST_ACCESS_BIT_ARB) + printf(" robustness"); + putchar('\n'); + + printf("%s context flags parsed by GLFW:", get_client_api_name(api)); + + if (glfwGetWindowAttrib(window, GLFW_OPENGL_FORWARD_COMPAT)) + printf(" forward-compatible"); + if (glfwGetWindowAttrib(window, GLFW_OPENGL_DEBUG_CONTEXT)) + printf(" debug"); + if (glfwGetWindowAttrib(window, GLFW_CONTEXT_ROBUSTNESS) != GLFW_NO_ROBUSTNESS) + printf(" robustness"); + putchar('\n'); + } + + if (major > 3 || (major == 3 && minor >= 2)) + { + int profile = glfwGetWindowAttrib(window, GLFW_OPENGL_PROFILE); + + glGetIntegerv(GL_CONTEXT_PROFILE_MASK, &mask); + printf("%s profile mask (0x%08x): %s\n", + get_client_api_name(api), + mask, + get_profile_name_gl(mask)); + + printf("%s profile mask parsed by GLFW: %s\n", + get_client_api_name(api), + get_profile_name_glfw(profile)); + } + + if (glfwExtensionSupported("GL_ARB_robustness")) + { + int robustness; + GLint strategy; + glGetIntegerv(GL_RESET_NOTIFICATION_STRATEGY_ARB, &strategy); + + printf("%s robustness strategy (0x%08x): %s\n", + get_client_api_name(api), + strategy, + get_strategy_name_gl(strategy)); + + robustness = glfwGetWindowAttrib(window, GLFW_CONTEXT_ROBUSTNESS); + + printf("%s robustness strategy parsed by GLFW: %s\n", + get_client_api_name(api), + get_strategy_name_glfw(robustness)); + } + } + + printf("%s context renderer string: \"%s\"\n", + get_client_api_name(api), + glGetString(GL_RENDERER)); + printf("%s context vendor string: \"%s\"\n", + get_client_api_name(api), + glGetString(GL_VENDOR)); + + if (major > 1) + { + printf("%s context shading language version: \"%s\"\n", + get_client_api_name(api), + glGetString(GL_SHADING_LANGUAGE_VERSION)); + } + + // Report client API extensions + if (list) + list_extensions(api, major, minor); + + glfwTerminate(); + exit(EXIT_SUCCESS); +} + diff --git a/extern/glfw/tests/iconify.c b/extern/glfw/tests/iconify.c new file mode 100644 index 0000000..361fe2f --- /dev/null +++ b/extern/glfw/tests/iconify.c @@ -0,0 +1,176 @@ +//======================================================================== +// Iconify/restore test program +// Copyright (c) Camilla Berglund +// +// This software is provided 'as-is', without any express or implied +// warranty. In no event will the authors be held liable for any damages +// arising from the use of this software. +// +// Permission is granted to anyone to use this software for any purpose, +// including commercial applications, and to alter it and redistribute it +// freely, subject to the following restrictions: +// +// 1. The origin of this software must not be misrepresented; you must not +// claim that you wrote the original software. If you use this software +// in a product, an acknowledgment in the product documentation would +// be appreciated but is not required. +// +// 2. Altered source versions must be plainly marked as such, and must not +// be misrepresented as being the original software. +// +// 3. This notice may not be removed or altered from any source +// distribution. +// +//======================================================================== +// +// This program is used to test the iconify/restore functionality for +// both fullscreen and windowed mode windows +// +//======================================================================== + +#include + +#include +#include + +#include "getopt.h" + +static void usage(void) +{ + printf("Usage: iconify [-h] [-f]\n"); +} + +static void error_callback(int error, const char* description) +{ + fprintf(stderr, "Error: %s\n", description); +} + +static void key_callback(GLFWwindow* window, int key, int scancode, int action, int mods) +{ + printf("%0.2f Key %s\n", + glfwGetTime(), + action == GLFW_PRESS ? "pressed" : "released"); + + if (action != GLFW_PRESS) + return; + + switch (key) + { + case GLFW_KEY_SPACE: + glfwIconifyWindow(window); + break; + case GLFW_KEY_ESCAPE: + glfwSetWindowShouldClose(window, GL_TRUE); + break; + } +} + +static void window_size_callback(GLFWwindow* window, int width, int height) +{ + printf("%0.2f Window resized to %ix%i\n", glfwGetTime(), width, height); +} + +static void framebuffer_size_callback(GLFWwindow* window, int width, int height) +{ + printf("%0.2f Framebuffer resized to %ix%i\n", glfwGetTime(), width, height); + + glViewport(0, 0, width, height); +} + +static void window_focus_callback(GLFWwindow* window, int focused) +{ + printf("%0.2f Window %s\n", + glfwGetTime(), + focused ? "focused" : "defocused"); +} + +static void window_iconify_callback(GLFWwindow* window, int iconified) +{ + printf("%0.2f Window %s\n", + glfwGetTime(), + iconified ? "iconified" : "restored"); +} + +int main(int argc, char** argv) +{ + int width, height, ch; + GLFWmonitor* monitor = NULL; + GLFWwindow* window; + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + exit(EXIT_FAILURE); + + while ((ch = getopt(argc, argv, "fh")) != -1) + { + switch (ch) + { + case 'h': + usage(); + exit(EXIT_SUCCESS); + + case 'f': + monitor = glfwGetPrimaryMonitor(); + break; + + default: + usage(); + exit(EXIT_FAILURE); + } + } + + if (monitor) + { + const GLFWvidmode* mode = glfwGetVideoMode(monitor); + width = mode->width; + height = mode->height; + } + else + { + width = 640; + height = 480; + } + + window = glfwCreateWindow(width, height, "Iconify", monitor, NULL); + if (!window) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + glfwMakeContextCurrent(window); + glfwSwapInterval(1); + + glfwSetKeyCallback(window, key_callback); + glfwSetFramebufferSizeCallback(window, framebuffer_size_callback); + glfwSetWindowSizeCallback(window, window_size_callback); + glfwSetWindowFocusCallback(window, window_focus_callback); + glfwSetWindowIconifyCallback(window, window_iconify_callback); + + printf("Window is %s and %s\n", + glfwGetWindowAttrib(window, GLFW_ICONIFIED) ? "iconified" : "restored", + glfwGetWindowAttrib(window, GLFW_FOCUSED) ? "focused" : "defocused"); + + glEnable(GL_SCISSOR_TEST); + + while (!glfwWindowShouldClose(window)) + { + glfwGetFramebufferSize(window, &width, &height); + + glScissor(0, 0, width, height); + glClearColor(0, 0, 0, 0); + glClear(GL_COLOR_BUFFER_BIT); + + glScissor(0, 0, 640, 480); + glClearColor(1, 1, 1, 0); + glClear(GL_COLOR_BUFFER_BIT); + + glfwSwapBuffers(window); + glfwPollEvents(); + } + + glfwTerminate(); + exit(EXIT_SUCCESS); +} + diff --git a/extern/glfw/tests/joysticks.c b/extern/glfw/tests/joysticks.c new file mode 100644 index 0000000..a3a5cd7 --- /dev/null +++ b/extern/glfw/tests/joysticks.c @@ -0,0 +1,234 @@ +//======================================================================== +// Joystick input test +// Copyright (c) Camilla Berglund +// +// This software is provided 'as-is', without any express or implied +// warranty. In no event will the authors be held liable for any damages +// arising from the use of this software. +// +// Permission is granted to anyone to use this software for any purpose, +// including commercial applications, and to alter it and redistribute it +// freely, subject to the following restrictions: +// +// 1. The origin of this software must not be misrepresented; you must not +// claim that you wrote the original software. If you use this software +// in a product, an acknowledgment in the product documentation would +// be appreciated but is not required. +// +// 2. Altered source versions must be plainly marked as such, and must not +// be misrepresented as being the original software. +// +// 3. This notice may not be removed or altered from any source +// distribution. +// +//======================================================================== +// +// This test displays the state of every button and axis of every connected +// joystick and/or gamepad +// +//======================================================================== + +#include + +#include +#include +#include + +#ifdef _MSC_VER +#define strdup(x) _strdup(x) +#endif + +typedef struct Joystick +{ + GLboolean present; + char* name; + float* axes; + unsigned char* buttons; + int axis_count; + int button_count; +} Joystick; + +static Joystick joysticks[GLFW_JOYSTICK_LAST - GLFW_JOYSTICK_1 + 1]; +static int joystick_count = 0; + +static void error_callback(int error, const char* description) +{ + fprintf(stderr, "Error: %s\n", description); +} + +static void framebuffer_size_callback(GLFWwindow* window, int width, int height) +{ + glViewport(0, 0, width, height); +} + +static void draw_joystick(Joystick* j, int x, int y, int width, int height) +{ + int i; + const int axis_height = 3 * height / 4; + const int button_height = height / 4; + + if (j->axis_count) + { + const int axis_width = width / j->axis_count; + + for (i = 0; i < j->axis_count; i++) + { + float value = j->axes[i] / 2.f + 0.5f; + + glColor3f(0.3f, 0.3f, 0.3f); + glRecti(x + i * axis_width, + y, + x + (i + 1) * axis_width, + y + axis_height); + + glColor3f(1.f, 1.f, 1.f); + glRecti(x + i * axis_width, + y + (int) (value * (axis_height - 5)), + x + (i + 1) * axis_width, + y + 5 + (int) (value * (axis_height - 5))); + } + } + + if (j->button_count) + { + const int button_width = width / j->button_count; + + for (i = 0; i < j->button_count; i++) + { + if (j->buttons[i]) + glColor3f(1.f, 1.f, 1.f); + else + glColor3f(0.3f, 0.3f, 0.3f); + + glRecti(x + i * button_width, + y + axis_height, + x + (i + 1) * button_width, + y + axis_height + button_height); + } + } +} + +static void draw_joysticks(GLFWwindow* window) +{ + int i, width, height; + + glfwGetFramebufferSize(window, &width, &height); + + glMatrixMode(GL_PROJECTION); + glLoadIdentity(); + glOrtho(0.f, width, height, 0.f, 1.f, -1.f); + glMatrixMode(GL_MODELVIEW); + + for (i = 0; i < sizeof(joysticks) / sizeof(Joystick); i++) + { + Joystick* j = joysticks + i; + + if (j->present) + { + draw_joystick(j, + 0, i * height / joystick_count, + width, height / joystick_count); + } + } +} + +static void refresh_joysticks(void) +{ + int i; + + for (i = 0; i < sizeof(joysticks) / sizeof(Joystick); i++) + { + Joystick* j = joysticks + i; + + if (glfwJoystickPresent(GLFW_JOYSTICK_1 + i)) + { + const float* axes; + const unsigned char* buttons; + int axis_count, button_count; + + free(j->name); + j->name = strdup(glfwGetJoystickName(GLFW_JOYSTICK_1 + i)); + + axes = glfwGetJoystickAxes(GLFW_JOYSTICK_1 + i, &axis_count); + if (axis_count != j->axis_count) + { + j->axis_count = axis_count; + j->axes = realloc(j->axes, j->axis_count * sizeof(float)); + } + + memcpy(j->axes, axes, axis_count * sizeof(float)); + + buttons = glfwGetJoystickButtons(GLFW_JOYSTICK_1 + i, &button_count); + if (button_count != j->button_count) + { + j->button_count = button_count; + j->buttons = realloc(j->buttons, j->button_count); + } + + memcpy(j->buttons, buttons, button_count * sizeof(unsigned char)); + + if (!j->present) + { + printf("Found joystick %i named \'%s\' with %i axes, %i buttons\n", + i + 1, j->name, j->axis_count, j->button_count); + + joystick_count++; + } + + j->present = GL_TRUE; + } + else + { + if (j->present) + { + printf("Lost joystick %i named \'%s\'\n", i + 1, j->name); + + free(j->name); + free(j->axes); + free(j->buttons); + memset(j, 0, sizeof(Joystick)); + + joystick_count--; + } + } + } +} + +int main(void) +{ + GLFWwindow* window; + + memset(joysticks, 0, sizeof(joysticks)); + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + exit(EXIT_FAILURE); + + window = glfwCreateWindow(640, 480, "Joystick Test", NULL, NULL); + if (!window) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + glfwSetFramebufferSizeCallback(window, framebuffer_size_callback); + + glfwMakeContextCurrent(window); + glfwSwapInterval(1); + + while (!glfwWindowShouldClose(window)) + { + glClear(GL_COLOR_BUFFER_BIT); + + refresh_joysticks(); + draw_joysticks(window); + + glfwSwapBuffers(window); + glfwPollEvents(); + } + + glfwTerminate(); + exit(EXIT_SUCCESS); +} + diff --git a/extern/glfw/tests/modes.c b/extern/glfw/tests/modes.c new file mode 100644 index 0000000..7635368 --- /dev/null +++ b/extern/glfw/tests/modes.c @@ -0,0 +1,239 @@ +//======================================================================== +// Video mode test +// Copyright (c) Camilla Berglund +// +// This software is provided 'as-is', without any express or implied +// warranty. In no event will the authors be held liable for any damages +// arising from the use of this software. +// +// Permission is granted to anyone to use this software for any purpose, +// including commercial applications, and to alter it and redistribute it +// freely, subject to the following restrictions: +// +// 1. The origin of this software must not be misrepresented; you must not +// claim that you wrote the original software. If you use this software +// in a product, an acknowledgment in the product documentation would +// be appreciated but is not required. +// +// 2. Altered source versions must be plainly marked as such, and must not +// be misrepresented as being the original software. +// +// 3. This notice may not be removed or altered from any source +// distribution. +// +//======================================================================== +// +// This test enumerates or verifies video modes +// +//======================================================================== + +#include + +#include +#include +#include + +#include "getopt.h" + +enum Mode +{ + LIST_MODE, + TEST_MODE +}; + +static void usage(void) +{ + printf("Usage: modes [-t]\n"); + printf(" modes -h\n"); +} + +static const char* format_mode(const GLFWvidmode* mode) +{ + static char buffer[512]; + + sprintf(buffer, + "%i x %i x %i (%i %i %i) %i Hz", + mode->width, mode->height, + mode->redBits + mode->greenBits + mode->blueBits, + mode->redBits, mode->greenBits, mode->blueBits, + mode->refreshRate); + + buffer[sizeof(buffer) - 1] = '\0'; + return buffer; +} + +static void error_callback(int error, const char* description) +{ + fprintf(stderr, "Error: %s\n", description); +} + +static void framebuffer_size_callback(GLFWwindow* window, int width, int height) +{ + printf("Framebuffer resized to %ix%i\n", width, height); + + glViewport(0, 0, width, height); +} + +static void key_callback(GLFWwindow* window, int key, int scancode, int action, int mods) +{ + if (key == GLFW_KEY_ESCAPE) + glfwSetWindowShouldClose(window, GL_TRUE); +} + +static void list_modes(GLFWmonitor* monitor) +{ + int count, x, y, widthMM, heightMM, dpi, i; + const GLFWvidmode* mode = glfwGetVideoMode(monitor); + const GLFWvidmode* modes = glfwGetVideoModes(monitor, &count); + + glfwGetMonitorPos(monitor, &x, &y); + glfwGetMonitorPhysicalSize(monitor, &widthMM, &heightMM); + + printf("Name: %s (%s)\n", + glfwGetMonitorName(monitor), + glfwGetPrimaryMonitor() == monitor ? "primary" : "secondary"); + printf("Current mode: %s\n", format_mode(mode)); + printf("Virtual position: %i %i\n", x, y); + + dpi = (int) ((float) mode->width * 25.4f / (float) widthMM); + printf("Physical size: %i x %i mm (%i dpi)\n", widthMM, heightMM, dpi); + + printf("Modes:\n"); + + for (i = 0; i < count; i++) + { + printf("%3u: %s", (unsigned int) i, format_mode(modes + i)); + + if (memcmp(mode, modes + i, sizeof(GLFWvidmode)) == 0) + printf(" (current mode)"); + + putchar('\n'); + } +} + +static void test_modes(GLFWmonitor* monitor) +{ + int i, count; + GLFWwindow* window; + const GLFWvidmode* modes = glfwGetVideoModes(monitor, &count); + + for (i = 0; i < count; i++) + { + const GLFWvidmode* mode = modes + i; + GLFWvidmode current; + + glfwWindowHint(GLFW_RED_BITS, mode->redBits); + glfwWindowHint(GLFW_GREEN_BITS, mode->greenBits); + glfwWindowHint(GLFW_BLUE_BITS, mode->blueBits); + + printf("Testing mode %u on monitor %s: %s\n", + (unsigned int) i, + glfwGetMonitorName(monitor), + format_mode(mode)); + + window = glfwCreateWindow(mode->width, mode->height, + "Video Mode Test", + glfwGetPrimaryMonitor(), + NULL); + if (!window) + { + printf("Failed to enter mode %u: %s\n", + (unsigned int) i, + format_mode(mode)); + continue; + } + + glfwSetFramebufferSizeCallback(window, framebuffer_size_callback); + glfwSetKeyCallback(window, key_callback); + + glfwMakeContextCurrent(window); + glfwSwapInterval(1); + + glfwSetTime(0.0); + + while (glfwGetTime() < 5.0) + { + glClear(GL_COLOR_BUFFER_BIT); + glfwSwapBuffers(window); + glfwPollEvents(); + + if (glfwWindowShouldClose(window)) + { + printf("User terminated program\n"); + + glfwTerminate(); + exit(EXIT_SUCCESS); + } + } + + glGetIntegerv(GL_RED_BITS, ¤t.redBits); + glGetIntegerv(GL_GREEN_BITS, ¤t.greenBits); + glGetIntegerv(GL_BLUE_BITS, ¤t.blueBits); + + glfwGetWindowSize(window, ¤t.width, ¤t.height); + + if (current.redBits != mode->redBits || + current.greenBits != mode->greenBits || + current.blueBits != mode->blueBits) + { + printf("*** Color bit mismatch: (%i %i %i) instead of (%i %i %i)\n", + current.redBits, current.greenBits, current.blueBits, + mode->redBits, mode->greenBits, mode->blueBits); + } + + if (current.width != mode->width || current.height != mode->height) + { + printf("*** Size mismatch: %ix%i instead of %ix%i\n", + current.width, current.height, + mode->width, mode->height); + } + + printf("Closing window\n"); + + glfwDestroyWindow(window); + window = NULL; + + glfwPollEvents(); + } +} + +int main(int argc, char** argv) +{ + int ch, i, count, mode = LIST_MODE; + GLFWmonitor** monitors; + + while ((ch = getopt(argc, argv, "th")) != -1) + { + switch (ch) + { + case 'h': + usage(); + exit(EXIT_SUCCESS); + case 't': + mode = TEST_MODE; + break; + default: + usage(); + exit(EXIT_FAILURE); + } + } + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + exit(EXIT_FAILURE); + + monitors = glfwGetMonitors(&count); + + for (i = 0; i < count; i++) + { + if (mode == LIST_MODE) + list_modes(monitors[i]); + else if (mode == TEST_MODE) + test_modes(monitors[i]); + } + + glfwTerminate(); + exit(EXIT_SUCCESS); +} + diff --git a/extern/glfw/tests/peter.c b/extern/glfw/tests/peter.c new file mode 100644 index 0000000..030ea50 --- /dev/null +++ b/extern/glfw/tests/peter.c @@ -0,0 +1,156 @@ +//======================================================================== +// Cursor input bug test +// Copyright (c) Camilla Berglund +// +// This software is provided 'as-is', without any express or implied +// warranty. In no event will the authors be held liable for any damages +// arising from the use of this software. +// +// Permission is granted to anyone to use this software for any purpose, +// including commercial applications, and to alter it and redistribute it +// freely, subject to the following restrictions: +// +// 1. The origin of this software must not be misrepresented; you must not +// claim that you wrote the original software. If you use this software +// in a product, an acknowledgment in the product documentation would +// be appreciated but is not required. +// +// 2. Altered source versions must be plainly marked as such, and must not +// be misrepresented as being the original software. +// +// 3. This notice may not be removed or altered from any source +// distribution. +// +//======================================================================== +// +// This test came about as the result of bugs #1262764, #1726540 and +// #1726592, all reported by the user peterpp, hence the name +// +// The utility of this test outside of these bugs is uncertain +// +//======================================================================== + +#include + +#include +#include + +static GLboolean reopen = GL_FALSE; +static double cursor_x; +static double cursor_y; + +static void toggle_cursor(GLFWwindow* window) +{ + if (glfwGetInputMode(window, GLFW_CURSOR) == GLFW_CURSOR_DISABLED) + { + printf("Released cursor\n"); + glfwSetInputMode(window, GLFW_CURSOR, GLFW_CURSOR_NORMAL); + } + else + { + printf("Captured cursor\n"); + glfwSetInputMode(window, GLFW_CURSOR, GLFW_CURSOR_DISABLED); + } +} + +static void error_callback(int error, const char* description) +{ + fprintf(stderr, "Error: %s\n", description); +} + +static void cursor_position_callback(GLFWwindow* window, double x, double y) +{ + printf("Cursor moved to: %f %f (%f %f)\n", x, y, x - cursor_x, y - cursor_y); + cursor_x = x; + cursor_y = y; +} + +static void key_callback(GLFWwindow* window, int key, int scancode, int action, int mods) +{ + switch (key) + { + case GLFW_KEY_SPACE: + { + if (action == GLFW_PRESS) + toggle_cursor(window); + + break; + } + + case GLFW_KEY_R: + { + if (action == GLFW_PRESS) + reopen = GL_TRUE; + + break; + } + } +} + +static void framebuffer_size_callback(GLFWwindow* window, int width, int height) +{ + glViewport(0, 0, width, height); +} + +static GLFWwindow* open_window(void) +{ + GLFWwindow* window = glfwCreateWindow(640, 480, "Peter Detector", NULL, NULL); + if (!window) + return NULL; + + glfwMakeContextCurrent(window); + glfwSwapInterval(1); + + glfwGetCursorPos(window, &cursor_x, &cursor_y); + printf("Cursor position: %f %f\n", cursor_x, cursor_y); + + glfwSetFramebufferSizeCallback(window, framebuffer_size_callback); + glfwSetCursorPosCallback(window, cursor_position_callback); + glfwSetKeyCallback(window, key_callback); + + return window; +} + +int main(void) +{ + GLFWwindow* window; + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + exit(EXIT_FAILURE); + + window = open_window(); + if (!window) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + glClearColor(0.f, 0.f, 0.f, 0.f); + + while (!glfwWindowShouldClose(window)) + { + glClear(GL_COLOR_BUFFER_BIT); + + glfwSwapBuffers(window); + glfwWaitEvents(); + + if (reopen) + { + glfwDestroyWindow(window); + window = open_window(); + if (!window) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + reopen = GL_FALSE; + } + } + + glfwTerminate(); + exit(EXIT_SUCCESS); +} + diff --git a/extern/glfw/tests/reopen.c b/extern/glfw/tests/reopen.c new file mode 100644 index 0000000..6f69b90 --- /dev/null +++ b/extern/glfw/tests/reopen.c @@ -0,0 +1,177 @@ +//======================================================================== +// Window re-opener (open/close stress test) +// Copyright (c) Camilla Berglund +// +// This software is provided 'as-is', without any express or implied +// warranty. In no event will the authors be held liable for any damages +// arising from the use of this software. +// +// Permission is granted to anyone to use this software for any purpose, +// including commercial applications, and to alter it and redistribute it +// freely, subject to the following restrictions: +// +// 1. The origin of this software must not be misrepresented; you must not +// claim that you wrote the original software. If you use this software +// in a product, an acknowledgment in the product documentation would +// be appreciated but is not required. +// +// 2. Altered source versions must be plainly marked as such, and must not +// be misrepresented as being the original software. +// +// 3. This notice may not be removed or altered from any source +// distribution. +// +//======================================================================== +// +// This test came about as the result of bug #1262773 +// +// It closes and re-opens the GLFW window every five seconds, alternating +// between windowed and fullscreen mode +// +// It also times and logs opening and closing actions and attempts to separate +// user initiated window closing from its own +// +//======================================================================== + +#include + +#include +#include +#include + +static void error_callback(int error, const char* description) +{ + fprintf(stderr, "Error: %s\n", description); +} + +static void framebuffer_size_callback(GLFWwindow* window, int width, int height) +{ + glViewport(0, 0, width, height); +} + +static void window_close_callback(GLFWwindow* window) +{ + printf("Close callback triggered\n"); +} + +static void key_callback(GLFWwindow* window, int key, int scancode, int action, int mods) +{ + if (action != GLFW_PRESS) + return; + + switch (key) + { + case GLFW_KEY_Q: + case GLFW_KEY_ESCAPE: + glfwSetWindowShouldClose(window, GL_TRUE); + break; + } +} + +static GLFWwindow* open_window(int width, int height, GLFWmonitor* monitor) +{ + double base; + GLFWwindow* window; + + base = glfwGetTime(); + + window = glfwCreateWindow(width, height, "Window Re-opener", monitor, NULL); + if (!window) + return NULL; + + glfwMakeContextCurrent(window); + glfwSwapInterval(1); + + glfwSetFramebufferSizeCallback(window, framebuffer_size_callback); + glfwSetWindowCloseCallback(window, window_close_callback); + glfwSetKeyCallback(window, key_callback); + + if (monitor) + { + printf("Opening full screen window on monitor %s took %0.3f seconds\n", + glfwGetMonitorName(monitor), + glfwGetTime() - base); + } + else + { + printf("Opening regular window took %0.3f seconds\n", + glfwGetTime() - base); + } + + return window; +} + +static void close_window(GLFWwindow* window) +{ + double base = glfwGetTime(); + glfwDestroyWindow(window); + printf("Closing window took %0.3f seconds\n", glfwGetTime() - base); +} + +int main(int argc, char** argv) +{ + int count = 0; + GLFWwindow* window; + + srand((unsigned int) time(NULL)); + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + exit(EXIT_FAILURE); + + for (;;) + { + GLFWmonitor* monitor = NULL; + + if (count & 1) + { + int monitorCount; + GLFWmonitor** monitors = glfwGetMonitors(&monitorCount); + monitor = monitors[rand() % monitorCount]; + } + + window = open_window(640, 480, monitor); + if (!window) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + glMatrixMode(GL_PROJECTION); + glOrtho(-1.f, 1.f, -1.f, 1.f, 1.f, -1.f); + glMatrixMode(GL_MODELVIEW); + + glfwSetTime(0.0); + + while (glfwGetTime() < 5.0) + { + glClear(GL_COLOR_BUFFER_BIT); + + glPushMatrix(); + glRotatef((GLfloat) glfwGetTime() * 100.f, 0.f, 0.f, 1.f); + glRectf(-0.5f, -0.5f, 1.f, 1.f); + glPopMatrix(); + + glfwSwapBuffers(window); + glfwPollEvents(); + + if (glfwWindowShouldClose(window)) + { + close_window(window); + printf("User closed window\n"); + + glfwTerminate(); + exit(EXIT_SUCCESS); + } + } + + printf("Closing window\n"); + close_window(window); + + count++; + } + + glfwTerminate(); +} + diff --git a/extern/glfw/tests/sharing.c b/extern/glfw/tests/sharing.c new file mode 100644 index 0000000..030ea11 --- /dev/null +++ b/extern/glfw/tests/sharing.c @@ -0,0 +1,185 @@ +//======================================================================== +// Context sharing test program +// Copyright (c) Camilla Berglund +// +// This software is provided 'as-is', without any express or implied +// warranty. In no event will the authors be held liable for any damages +// arising from the use of this software. +// +// Permission is granted to anyone to use this software for any purpose, +// including commercial applications, and to alter it and redistribute it +// freely, subject to the following restrictions: +// +// 1. The origin of this software must not be misrepresented; you must not +// claim that you wrote the original software. If you use this software +// in a product, an acknowledgment in the product documentation would +// be appreciated but is not required. +// +// 2. Altered source versions must be plainly marked as such, and must not +// be misrepresented as being the original software. +// +// 3. This notice may not be removed or altered from any source +// distribution. +// +//======================================================================== +// +// This program is used to test sharing of objects between contexts +// +//======================================================================== + +#define GLFW_INCLUDE_GLU +#include + +#include +#include + +#define WIDTH 400 +#define HEIGHT 400 +#define OFFSET 50 + +static GLFWwindow* windows[2]; + +static void error_callback(int error, const char* description) +{ + fprintf(stderr, "Error: %s\n", description); +} + +static void key_callback(GLFWwindow* window, int key, int scancode, int action, int mods) +{ + if (action == GLFW_PRESS && key == GLFW_KEY_ESCAPE) + glfwSetWindowShouldClose(window, GL_TRUE); +} + +static GLFWwindow* open_window(const char* title, GLFWwindow* share, int posX, int posY) +{ + GLFWwindow* window; + + glfwWindowHint(GLFW_VISIBLE, GL_FALSE); + window = glfwCreateWindow(WIDTH, HEIGHT, title, NULL, share); + if (!window) + return NULL; + + glfwMakeContextCurrent(window); + glfwSwapInterval(1); + glfwSetWindowPos(window, posX, posY); + glfwShowWindow(window); + + glfwSetKeyCallback(window, key_callback); + + return window; +} + +static GLuint create_texture(void) +{ + int x, y; + char pixels[256 * 256]; + GLuint texture; + + glGenTextures(1, &texture); + glBindTexture(GL_TEXTURE_2D, texture); + + for (y = 0; y < 256; y++) + { + for (x = 0; x < 256; x++) + pixels[y * 256 + x] = rand() % 256; + } + + glTexImage2D(GL_TEXTURE_2D, 0, GL_LUMINANCE, 256, 256, 0, GL_LUMINANCE, GL_UNSIGNED_BYTE, pixels); + glTexParameteri(GL_TEXTURE_2D, GL_TEXTURE_MIN_FILTER, GL_LINEAR); + glTexParameteri(GL_TEXTURE_2D, GL_TEXTURE_MAG_FILTER, GL_LINEAR); + + return texture; +} + +static void draw_quad(GLuint texture) +{ + int width, height; + glfwGetFramebufferSize(glfwGetCurrentContext(), &width, &height); + + glViewport(0, 0, width, height); + + glMatrixMode(GL_PROJECTION); + glLoadIdentity(); + gluOrtho2D(0.f, 1.f, 0.f, 1.f); + + glEnable(GL_TEXTURE_2D); + glBindTexture(GL_TEXTURE_2D, texture); + glTexEnvi(GL_TEXTURE_ENV, GL_TEXTURE_ENV_MODE, GL_MODULATE); + + glBegin(GL_QUADS); + + glTexCoord2f(0.f, 0.f); + glVertex2f(0.f, 0.f); + + glTexCoord2f(1.f, 0.f); + glVertex2f(1.f, 0.f); + + glTexCoord2f(1.f, 1.f); + glVertex2f(1.f, 1.f); + + glTexCoord2f(0.f, 1.f); + glVertex2f(0.f, 1.f); + + glEnd(); +} + +int main(int argc, char** argv) +{ + int x, y, width; + GLuint texture; + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + exit(EXIT_FAILURE); + + windows[0] = open_window("First", NULL, OFFSET, OFFSET); + if (!windows[0]) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + // This is the one and only time we create a texture + // It is created inside the first context, created above + // It will then be shared with the second context, created below + texture = create_texture(); + + glfwGetWindowPos(windows[0], &x, &y); + glfwGetWindowSize(windows[0], &width, NULL); + + // Put the second window to the right of the first one + windows[1] = open_window("Second", windows[0], x + width + OFFSET, y); + if (!windows[1]) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + // Set drawing color for both contexts + glfwMakeContextCurrent(windows[0]); + glColor3f(0.6f, 0.f, 0.6f); + glfwMakeContextCurrent(windows[1]); + glColor3f(0.6f, 0.6f, 0.f); + + glfwMakeContextCurrent(windows[0]); + + while (!glfwWindowShouldClose(windows[0]) && + !glfwWindowShouldClose(windows[1])) + { + glfwMakeContextCurrent(windows[0]); + draw_quad(texture); + + glfwMakeContextCurrent(windows[1]); + draw_quad(texture); + + glfwSwapBuffers(windows[0]); + glfwSwapBuffers(windows[1]); + + glfwWaitEvents(); + } + + glfwTerminate(); + exit(EXIT_SUCCESS); +} + diff --git a/extern/glfw/tests/tearing.c b/extern/glfw/tests/tearing.c new file mode 100644 index 0000000..94865fa --- /dev/null +++ b/extern/glfw/tests/tearing.c @@ -0,0 +1,130 @@ +//======================================================================== +// Vsync enabling test +// Copyright (c) Camilla Berglund +// +// This software is provided 'as-is', without any express or implied +// warranty. In no event will the authors be held liable for any damages +// arising from the use of this software. +// +// Permission is granted to anyone to use this software for any purpose, +// including commercial applications, and to alter it and redistribute it +// freely, subject to the following restrictions: +// +// 1. The origin of this software must not be misrepresented; you must not +// claim that you wrote the original software. If you use this software +// in a product, an acknowledgment in the product documentation would +// be appreciated but is not required. +// +// 2. Altered source versions must be plainly marked as such, and must not +// be misrepresented as being the original software. +// +// 3. This notice may not be removed or altered from any source +// distribution. +// +//======================================================================== +// +// This test renders a high contrast, horizontally moving bar, allowing for +// visual verification of whether the set swap interval is indeed obeyed +// +//======================================================================== + +#include + +#include +#include +#include + +static int swap_interval; +static double frame_rate; + +static void update_window_title(GLFWwindow* window) +{ + char title[256]; + + sprintf(title, "Tearing detector (interval %i, %0.1f Hz)", + swap_interval, frame_rate); + + glfwSetWindowTitle(window, title); +} + +static void set_swap_interval(GLFWwindow* window, int interval) +{ + swap_interval = interval; + glfwSwapInterval(swap_interval); + update_window_title(window); +} + +static void error_callback(int error, const char* description) +{ + fprintf(stderr, "Error: %s\n", description); +} + +static void framebuffer_size_callback(GLFWwindow* window, int width, int height) +{ + glViewport(0, 0, width, height); +} + +static void key_callback(GLFWwindow* window, int key, int scancode, int action, int mods) +{ + if (key == GLFW_KEY_SPACE && action == GLFW_PRESS) + set_swap_interval(window, 1 - swap_interval); +} + +int main(void) +{ + float position; + unsigned long frame_count = 0; + double last_time, current_time; + GLFWwindow* window; + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + exit(EXIT_FAILURE); + + window = glfwCreateWindow(640, 480, "", NULL, NULL); + if (!window) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + glfwMakeContextCurrent(window); + set_swap_interval(window, 0); + + last_time = glfwGetTime(); + frame_rate = 0.0; + + glfwSetFramebufferSizeCallback(window, framebuffer_size_callback); + glfwSetKeyCallback(window, key_callback); + + glMatrixMode(GL_PROJECTION); + glOrtho(-1.f, 1.f, -1.f, 1.f, 1.f, -1.f); + glMatrixMode(GL_MODELVIEW); + + while (!glfwWindowShouldClose(window)) + { + glClear(GL_COLOR_BUFFER_BIT); + + position = cosf((float) glfwGetTime() * 4.f) * 0.75f; + glRectf(position - 0.25f, -1.f, position + 0.25f, 1.f); + + glfwSwapBuffers(window); + glfwPollEvents(); + + frame_count++; + + current_time = glfwGetTime(); + if (current_time - last_time > 1.0) + { + frame_rate = frame_count / (current_time - last_time); + frame_count = 0; + last_time = current_time; + update_window_title(window); + } + } + + glfwTerminate(); + exit(EXIT_SUCCESS); +} + diff --git a/extern/glfw/tests/threads.c b/extern/glfw/tests/threads.c new file mode 100644 index 0000000..f4fcdd9 --- /dev/null +++ b/extern/glfw/tests/threads.c @@ -0,0 +1,132 @@ +//======================================================================== +// Multithreading test +// Copyright (c) Camilla Berglund +// +// This software is provided 'as-is', without any express or implied +// warranty. In no event will the authors be held liable for any damages +// arising from the use of this software. +// +// Permission is granted to anyone to use this software for any purpose, +// including commercial applications, and to alter it and redistribute it +// freely, subject to the following restrictions: +// +// 1. The origin of this software must not be misrepresented; you must not +// claim that you wrote the original software. If you use this software +// in a product, an acknowledgment in the product documentation would +// be appreciated but is not required. +// +// 2. Altered source versions must be plainly marked as such, and must not +// be misrepresented as being the original software. +// +// 3. This notice may not be removed or altered from any source +// distribution. +// +//======================================================================== +// +// This test is intended to verify whether the OpenGL context part of +// the GLFW API is able to be used from multiple threads +// +//======================================================================== + +#include "tinycthread.h" + +#include + +#include +#include +#include + +typedef struct +{ + GLFWwindow* window; + const char* title; + float r, g, b; + thrd_t id; +} Thread; + +static volatile GLboolean running = GL_TRUE; + +static void error_callback(int error, const char* description) +{ + fprintf(stderr, "Error: %s\n", description); +} + +static int thread_main(void* data) +{ + const Thread* thread = (const Thread*) data; + + glfwMakeContextCurrent(thread->window); + glfwSwapInterval(1); + + while (running) + { + const float v = (float) fabs(sin(glfwGetTime() * 2.f)); + glClearColor(thread->r * v, thread->g * v, thread->b * v, 0.f); + + glClear(GL_COLOR_BUFFER_BIT); + glfwSwapBuffers(thread->window); + } + + glfwMakeContextCurrent(NULL); + return 0; +} + +int main(void) +{ + int i, result; + Thread threads[] = + { + { NULL, "Red", 1.f, 0.f, 0.f, 0 }, + { NULL, "Green", 0.f, 1.f, 0.f, 0 }, + { NULL, "Blue", 0.f, 0.f, 1.f, 0 } + }; + const int count = sizeof(threads) / sizeof(Thread); + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + exit(EXIT_FAILURE); + + glfwWindowHint(GLFW_VISIBLE, GL_FALSE); + + for (i = 0; i < count; i++) + { + threads[i].window = glfwCreateWindow(200, 200, + threads[i].title, + NULL, NULL); + if (!threads[i].window) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + glfwSetWindowPos(threads[i].window, 200 + 250 * i, 200); + glfwShowWindow(threads[i].window); + + if (thrd_create(&threads[i].id, thread_main, threads + i) != + thrd_success) + { + fprintf(stderr, "Failed to create secondary thread\n"); + + glfwTerminate(); + exit(EXIT_FAILURE); + } + } + + while (running) + { + glfwWaitEvents(); + + for (i = 0; i < count; i++) + { + if (glfwWindowShouldClose(threads[i].window)) + running = GL_FALSE; + } + } + + for (i = 0; i < count; i++) + thrd_join(threads[i].id, &result); + + exit(EXIT_SUCCESS); +} + diff --git a/extern/glfw/tests/title.c b/extern/glfw/tests/title.c new file mode 100644 index 0000000..15ddb83 --- /dev/null +++ b/extern/glfw/tests/title.c @@ -0,0 +1,76 @@ +//======================================================================== +// UTF-8 window title test +// Copyright (c) Camilla Berglund +// +// This software is provided 'as-is', without any express or implied +// warranty. In no event will the authors be held liable for any damages +// arising from the use of this software. +// +// Permission is granted to anyone to use this software for any purpose, +// including commercial applications, and to alter it and redistribute it +// freely, subject to the following restrictions: +// +// 1. The origin of this software must not be misrepresented; you must not +// claim that you wrote the original software. If you use this software +// in a product, an acknowledgment in the product documentation would +// be appreciated but is not required. +// +// 2. Altered source versions must be plainly marked as such, and must not +// be misrepresented as being the original software. +// +// 3. This notice may not be removed or altered from any source +// distribution. +// +//======================================================================== +// +// This test sets a UTF-8 window title +// +//======================================================================== + +#include + +#include +#include + +static void error_callback(int error, const char* description) +{ + fprintf(stderr, "Error: %s\n", description); +} + +static void framebuffer_size_callback(GLFWwindow* window, int width, int height) +{ + glViewport(0, 0, width, height); +} + +int main(void) +{ + GLFWwindow* window; + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + exit(EXIT_FAILURE); + + window = glfwCreateWindow(400, 400, "English 日本語 русский язык 官話", NULL, NULL); + if (!window) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + glfwMakeContextCurrent(window); + glfwSwapInterval(1); + + glfwSetFramebufferSizeCallback(window, framebuffer_size_callback); + + while (!glfwWindowShouldClose(window)) + { + glClear(GL_COLOR_BUFFER_BIT); + glfwSwapBuffers(window); + glfwWaitEvents(); + } + + glfwTerminate(); + exit(EXIT_SUCCESS); +} + diff --git a/extern/glfw/tests/windows.c b/extern/glfw/tests/windows.c new file mode 100644 index 0000000..b8ad663 --- /dev/null +++ b/extern/glfw/tests/windows.c @@ -0,0 +1,98 @@ +//======================================================================== +// Simple multi-window test +// Copyright (c) Camilla Berglund +// +// This software is provided 'as-is', without any express or implied +// warranty. In no event will the authors be held liable for any damages +// arising from the use of this software. +// +// Permission is granted to anyone to use this software for any purpose, +// including commercial applications, and to alter it and redistribute it +// freely, subject to the following restrictions: +// +// 1. The origin of this software must not be misrepresented; you must not +// claim that you wrote the original software. If you use this software +// in a product, an acknowledgment in the product documentation would +// be appreciated but is not required. +// +// 2. Altered source versions must be plainly marked as such, and must not +// be misrepresented as being the original software. +// +// 3. This notice may not be removed or altered from any source +// distribution. +// +//======================================================================== +// +// This test creates four windows and clears each in a different color +// +//======================================================================== + +#include + +#include +#include + +static const char* titles[] = +{ + "Foo", + "Bar", + "Baz", + "Quux" +}; + +static void error_callback(int error, const char* description) +{ + fprintf(stderr, "Error: %s\n", description); +} + +int main(void) +{ + int i; + GLboolean running = GL_TRUE; + GLFWwindow* windows[4]; + + glfwSetErrorCallback(error_callback); + + if (!glfwInit()) + exit(EXIT_FAILURE); + + glfwWindowHint(GLFW_VISIBLE, GL_FALSE); + + for (i = 0; i < 4; i++) + { + windows[i] = glfwCreateWindow(200, 200, titles[i], NULL, NULL); + if (!windows[i]) + { + glfwTerminate(); + exit(EXIT_FAILURE); + } + + glfwMakeContextCurrent(windows[i]); + glClearColor((GLclampf) (i & 1), + (GLclampf) (i >> 1), + i ? 0.f : 1.f, + 0.f); + + glfwSetWindowPos(windows[i], 100 + (i & 1) * 300, 100 + (i >> 1) * 300); + glfwShowWindow(windows[i]); + } + + while (running) + { + for (i = 0; i < 4; i++) + { + glfwMakeContextCurrent(windows[i]); + glClear(GL_COLOR_BUFFER_BIT); + glfwSwapBuffers(windows[i]); + + if (glfwWindowShouldClose(windows[i])) + running = GL_FALSE; + } + + glfwPollEvents(); + } + + glfwTerminate(); + exit(EXIT_SUCCESS); +} +